Recombinant Penicillium chrysogenum ATP synthase subunit a (atp6)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP synthase subunit a is a core component of the F<sub>O</sub> domain, facilitating proton translocation across the mitochondrial inner membrane. Key functions:

  • Proton Transport: Enables proton flow to drive ATP synthesis via rotational catalysis .

  • Structural Stability: Interacts with subunit 8 (ATP8) to stabilize the F<sub>O</sub> stator .

  • Pathogenic Mutations: Mutations in homologous human MT-ATP6 cause Leigh syndrome and neuromuscular disorders .

3.1. Mechanistic Studies

  • Enzyme Assembly: Used to probe F<sub>O</sub> assembly defects in yeast models, revealing dependencies on F<sub>1</sub> subunits (e.g., ATP1, ATP2) for translational regulation .

  • Proton Channel Modeling: Structural insights from Penicillium homologs aid in mapping mutation-induced disruptions (e.g., altered helices in MT-ATP6 linked to ATP synthesis failure) .

3.2. Disease Modeling

  • Mitochondrial Disorders: Recombinant ATP6 enables in vitro study of mutations like m.8993T>G (linked to neuropathy and ataxia) .

  • Drug Screening: Serves as a target for inhibitors (e.g., oligomycin) to dissect F<sub>O</sub> function .

Production and Quality Control

  • Expression System: E. coli ensures high yield (~1 mg/mL post-reconstitution) .

  • Validation: Confirmed via Western blot (His-tag antibodies) and functional assays (proton flux measurements) .

  • Stability: Sensitive to freeze-thaw cycles; requires glycerol stabilization for long-term storage .

Comparative Insights

FeatureP. chrysogenum ATP6 S. cerevisiae ATP6
HostE. coliE. coli
Amino Acid Range9–25711–259
TagHisHis
ApplicationsEnzyme kinetics, structural studiesAssembly regulation studies

Clinical and Industrial Relevance

  • Biomarker Development: Autoantibodies against ATP6 are explored in autoimmune disease diagnostics .

  • Agricultural Adaptation: ATP6/ATP8 polymorphisms correlate with high-altitude adaptation in yaks, highlighting evolutionary significance .

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis to resolve proton channel dynamics .

  • Gene Therapy: Delivery of recombinant ATP6 to rescue mitochondrial defects in patient-derived cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
9-257
Protein Length
Full Length of Mature Protein
Species
Penicillium chrysogenum (Penicillium notatum)
Target Names
atp6
Target Protein Sequence
SPLDQFEVRDLFSLNANLLGNLHLSLTNIGLYLTISIFLILTYSLLATNNNKIIPNNWSI SQESIYATVHGIVVNQINPNKGQMFFPLMYVLFIFILVNNLIGLVPYSFASTSHFILTFS ISFTVVLGATILGFQRHGLKFFSLFVPSGCPLALLPLLVLIEFISYLSRNVSLGLRLAAN ILSGHMLLSILSGFTYNIMTSGIIFFILGLIPLAFIIAFSGLELAIAFIQAQVFVVLACS YIKDGLDLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) – containing the extramembraneous catalytic core, and F(0) – containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit is a key component of the proton channel, potentially playing a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Penicillium chrysogenum and why is it significant for ATP synthase research?

Penicillium chrysogenum (now reclassified as P. rubens) has been extensively studied as a model organism for secondary metabolite production. Though primarily known for penicillin production, P. chrysogenum possesses diverse metabolic capabilities including the expression of various enzymes important for energy metabolism . ATP synthase is a critical enzyme complex for energy production, and studying its structure and function in P. chrysogenum provides insights into how this industrially important fungus manages energy requirements during secondary metabolite biosynthesis.

Methodological approach: Researchers typically begin by comparing genomic sequences of P. chrysogenum ATP synthase genes with other well-characterized fungal species. This can be done through genome mining of sequenced P. chrysogenum strains such as Wisconsin 54-1255 (which has become a standard reference strain for research) or more recent isolates with distinctive metabolic properties .

  • How is the ATP synthase complex organized in P. chrysogenum compared to other fungi?

Based on studies of fungal ATP synthases, P. chrysogenum ATP synthase likely consists of two major portions: F₁ (containing catalytic sites) and F₀ (membrane-embedded proton channel). The atp6 gene encodes a critical component of the F₀ portion that facilitates proton movement across the membrane. Like other enzymes in P. chrysogenum, ATP synthase may have unique structural features that contribute to its stability and function under various environmental conditions .

Methodological approach: Researchers can employ comparative protein structure prediction, homology modeling, and experimental approaches such as blue native PAGE to determine the oligomeric state and subunit composition of the ATP synthase complex. From the C-terminal domain studies of ATP sulfurylase in P. chrysogenum, we can infer that similar domains might play roles in stabilizing the quaternary structure of ATP synthase .

  • What techniques are most effective for isolating and expressing recombinant atp6 from P. chrysogenum?

Expressing membrane proteins like ATP synthase subunit a presents significant challenges due to their hydrophobic nature and complex integration into membranes.

Methodological approach: Based on successful approaches with other P. chrysogenum enzymes, researchers should consider:

Expression SystemAdvantagesChallenges
E. coliRapid growth, high yieldMay form inclusion bodies with membrane proteins
Pichia pastorisEukaryotic processing, high expressionLonger development time
Homologous expression in P. chrysogenumNative environment, proper foldingMore complex genetic manipulation

For purification, researchers should implement:

  • Detergent screening for optimal solubilization

  • Affinity chromatography (if tagged constructs are used)

  • Size exclusion chromatography to isolate intact complexes

  • Reconstitution into liposomes for functional studies

  • How does the genomic context of atp6 in P. chrysogenum compare to other genes involved in energy metabolism?

In P. chrysogenum, energy metabolism genes often show coordinated expression with secondary metabolism genes. While specific information about atp6 genomic context is limited in the search results, understanding its organization provides insights into regulatory mechanisms.

Methodological approach: Researchers should perform comparative genomic analysis of the mitochondrial genome where atp6 is typically located. The search results indicate that P. chrysogenum has undergone chromosomal rearrangements during strain improvement programs, which may have affected the regulation of energy metabolism genes . Analysis techniques should include:

  • Whole genome sequencing of different strains

  • Comparison of gene synteny across related species

  • Identification of regulatory elements in promoter regions

  • RNA-seq analysis to identify co-expressed genes

  • What methods are recommended for measuring ATP synthase activity in recombinant P. chrysogenum systems?

Accurate measurement of ATP synthase activity is critical for understanding its role in cellular metabolism.

Methodological approach: Based on approaches used for other P. chrysogenum enzymes, researchers should consider:

  • ATP synthesis assays: Measuring ATP production in reconstituted systems using luciferase-based detection

  • ATP hydrolysis assays: Monitoring inorganic phosphate release using colorimetric methods

  • Proton translocation assays: Using pH-sensitive fluorescent dyes to monitor proton movement

  • Membrane potential measurements: Employing potential-sensitive dyes to assess the coupling between proton movement and ATP synthesis

Researchers should be aware that the kinetic properties of recombinant enzymes may differ from native ones, as demonstrated with ATP sulfurylase from P. chrysogenum where removal of the C-terminal domain significantly altered kinetic parameters (decreasing kcat values to 17% of wild-type values) .

Advanced Research Questions

  • How do mutations in the atp6 gene affect energy metabolism and secondary metabolite production in P. chrysogenum?

Mutations in atp6 could have far-reaching effects on cellular metabolism due to ATP synthase's central role in energy production.

Methodological approach: Researchers should implement a multi-omics strategy:

  • Generate atp6 mutants using CRISPR-Cas9 or traditional mutagenesis

  • Characterize growth phenotypes under various carbon sources

  • Measure ATP/ADP ratios and energy charge in mutant strains

  • Quantify secondary metabolite production, particularly penicillin

  • Perform metabolic flux analysis using 13C-labeled substrates

  • Conduct transcriptome and proteome analysis to identify compensatory mechanisms

The search results indicate that P. chrysogenum strains with different penicillin production capacities (such as strain 28R-6-F01 producing almost twice as much penicillin as Wisconsin54-1255) may have underlying differences in energy metabolism that contribute to these phenotypes .

  • How does the structure-function relationship of recombinant atp6 compare between different P. chrysogenum strains?

Different P. chrysogenum strains show variations in metabolic capabilities, which may correlate with differences in ATP synthase structure and function.

Methodological approach: Researchers should conduct comparative studies including:

  • Sequence analysis of atp6 across multiple strains (industrial vs. wild-type)

  • Homology modeling to predict structural differences

  • Site-directed mutagenesis to test the functional significance of strain-specific variations

  • Measurement of enzyme kinetics parameters (Km, kcat, efficiency)

  • Assessment of stability under various pH and temperature conditions

The search results demonstrate that genomic rearrangements are common in P. chrysogenum strains and may affect genes involved in metabolism. For instance, the penicillin biosynthetic gene cluster shows structural differences between strains, suggesting similar variations might exist in energy metabolism genes .

  • What is the relationship between ATP synthase activity and stress response mechanisms in P. chrysogenum?

P. chrysogenum has remarkable adaptability to diverse environments, including deep subseafloor sediments, suggesting sophisticated stress response mechanisms that may involve energy metabolism modulation.

Methodological approach: To investigate this relationship, researchers should:

  • Expose P. chrysogenum cultures to various stressors (oxidative, osmotic, pH, nutrient limitation)

  • Monitor ATP synthase activity and ATP production rates under stress conditions

  • Analyze transcriptional responses of atp6 and other ATP synthase genes during stress

  • Create reporter constructs to visualize ATP synthase expression in response to stress

  • Compare stress tolerance between strains with different ATP synthase activities

The search results mention a P. chrysogenum strain (28R-6-F01) isolated from deep subseafloor sediment with genetic differences from terrestrial strains, suggesting adaptations in energy metabolism for survival in extreme environments .

  • How can directed evolution approaches be applied to optimize recombinant P. chrysogenum ATP synthase for specific research applications?

Directed evolution offers powerful tools to engineer enzymes with enhanced properties for research applications.

Methodological approach: Researchers should implement:

Directed Evolution StrategyApplication to ATP synthaseExpected Outcome
Error-prone PCRIntroduce random mutations in atp6Variants with altered activity/stability
DNA shufflingRecombine atp6 sequences from different strainsChimeric proteins with novel properties
CRISPR-based evolutionPrecise editing of specific residuesStructure-guided improvements
Ribosome displaySelection for specific binding propertiesATP synthase variants with altered regulation

Success metrics should include improved expression levels, stability in different detergents, enhanced activity, or altered regulatory properties. The approach used for classical strain improvement of P. chrysogenum for penicillin production (which increased yields by several thousand-fold) provides a precedent for successful enzyme engineering in this organism .

  • What are the molecular mechanisms underlying the potential differences in ATP synthase efficiency between high-producing and wild-type P. chrysogenum strains?

Industrial strains of P. chrysogenum developed through classical strain improvement programs may have acquired optimizations in energy metabolism.

Methodological approach: A comprehensive investigation should include:

  • Comparative genomics of ATP synthase genes across strain lineages

  • Transcriptome analysis to quantify expression levels

  • Proteomics to assess post-translational modifications

  • Mitochondrial function assays (respiration rates, membrane potential)

  • In vitro reconstitution of ATP synthase from different strains

  • Metabolic control analysis to determine flux control coefficients

The search results indicate that classical strain improvement programs have led to numerous genomic changes in P. chrysogenum, including chromosomal rearrangements that may affect the regulation and expression of various enzymes . Similar changes might exist in the mitochondrial genome affecting ATP synthase genes.

  • How do the kinetic properties of ATP synthase correlate with the metabolic flux distribution in penicillin-producing conditions?

Understanding the relationship between ATP synthesis and metabolic flux is crucial for optimizing secondary metabolite production.

Methodological approach: Researchers should implement:

  • 13C metabolic flux analysis during penicillin production

  • Measurement of ATP synthase activity at different production phases

  • Determination of respiratory quotient during fermentation

  • Analysis of ATP consuming processes during penicillin biosynthesis

  • Mathematical modeling of energy metabolism coupled to penicillin production

The search results mention that penicillin biosynthesis requires specific metabolic precursors like phenylacetic acid (PAA), and the metabolism of these precursors can significantly affect production yields . Energy requirements for biosynthesis and transport of these compounds would be influenced by ATP synthase efficiency.

  • What role does the C-terminal domain play in the stability and function of recombinant P. chrysogenum ATP synthase subunits?

Based on studies of other P. chrysogenum enzymes, C-terminal domains can significantly impact enzyme function and stability.

Methodological approach: To investigate this question, researchers should:

  • Create truncated versions of ATP synthase subunits lacking C-terminal domains

  • Assess the impact on complex assembly and stability

  • Measure enzyme kinetics parameters of truncated versus full-length complexes

  • Determine the role in regulatory interactions with other proteins or metabolites

  • Perform thermal stability assays to quantify stabilization effects

The search results demonstrate that in ATP sulfurylase from P. chrysogenum, the C-terminal domain serves multiple functions: it acts as a receptor for allosteric inhibitors, stabilizes the hexameric structure, and optimizes catalytic site function. Removal of this domain resulted in a monomeric enzyme with decreased catalytic efficiency . Similar multifunctional roles might exist in ATP synthase subunits.

Through systematic investigation of these questions, researchers can gain deeper insights into the structure, function, and biotechnological potential of recombinant P. chrysogenum ATP synthase subunit a (atp6), ultimately contributing to our understanding of energy metabolism in this important industrial microorganism.

Experimental Considerations for Recombinant P. chrysogenum ATP Synthase Research

  • What are the critical quality control parameters for ensuring functional integrity of recombinant P. chrysogenum ATP synthase preparations?

Ensuring the functional integrity of recombinant ATP synthase is essential for obtaining reliable experimental data.

Methodological approach: Researchers should implement a comprehensive quality control pipeline:

Quality Control ParameterMethodAcceptance Criteria
PuritySDS-PAGE, silver staining>95% purity
Complex integrityBlue native PAGE, size exclusion chromatographyCorrect oligomeric state
Specific activityATP synthesis/hydrolysis assaysWithin 20% of native enzyme
Proton couplingH+/ATP ratio measurementStoichiometric coupling
Thermal stabilityDifferential scanning calorimetryTm within 5°C of native enzyme

Lessons from ATP sulfurylase studies in P. chrysogenum indicate that recombinant versions may show altered kinetic properties compared to wild-type enzymes, highlighting the importance of thorough characterization .

  • How can researchers address the challenges of expressing mitochondrially-encoded atp6 in heterologous systems?

The mitochondrial origin of atp6 presents unique challenges for recombinant expression.

Methodological approach: Researchers should consider:

  • Nuclear relocalization strategy: Clone the mitochondrial gene sequence with appropriate nuclear targeting signals

  • Codon optimization: Adjust codons for the expression host while accounting for possible mitochondrial genetic code differences

  • Synthetic gene approach: Design synthetic genes with optimized codons and appropriate regulatory elements

  • Homologous expression: Express within P. chrysogenum itself with appropriate targeting signals

  • Cell-free expression systems: Utilize systems optimized for membrane protein production

The search results indicate that P. chrysogenum has been successfully engineered to express various recombinant proteins, suggesting that adaptation of these approaches for ATP synthase subunits is feasible .

  • What comparative proteomic approaches would be most informative for studying ATP synthase variations across P. chrysogenum strains?

Proteomic analysis can reveal strain-specific differences in ATP synthase expression, modification, and complex formation.

Methodological approach: A comprehensive proteomic strategy should include:

  • Quantitative proteomics to determine absolute concentrations of ATP synthase subunits

  • Phosphoproteomics to identify regulatory modifications

  • Interactome analysis to map strain-specific protein-protein interactions

  • Mitochondrial proteome profiling to understand the broader context

  • Time-course analysis during growth and secondary metabolite production phases

The search results demonstrate that P. chrysogenum strains show significant differences in secondary metabolite production capabilities, suggesting underlying differences in metabolism that might be reflected in the mitochondrial proteome .

By systematically addressing these research questions, investigators can advance our understanding of ATP synthase biology in P. chrysogenum and potentially leverage this knowledge for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.