Recombinant Penicillium chrysogenum Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mic60; Pc13g07690; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
62-646
Protein Length
Full Length of Mature Protein
Species
Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum)
Target Names
mic60
Target Protein Sequence
ADSKPPTTGGPTPVSPSSESSVPPETISKAAEQESKLPPSPPAAAPRKSGRFRRFLIYLI LTSGFAYGGSIFLALKFDNFHDFFTEYIPYGEESVLYFEERDFYRRFPNALRHPNRLPAA PREEGKPVTIPSKSGLSWKVAEEQKADADSKKAEAAHEGQIKPAAAKPEERNAAVVKAKE DTASKHSTKEAKPESEAKSPVSLDEPRKPAVSASTIELLQLQDGDDTVVQDLVKTFNDIV TVISADENSNKYSAPVAKAKGELEKIAEKIAAIRSEARNTAQEELNKLHATFDESARELM RQFEEVRSTDLASFREEFEAEREKLALAYQQKVNTELRHAQELAEQRLQNELVEQAIELN RKYVHEVKSLVEREREGRLSKLTELTADVNELEKLTAGWSDVIDANLKTQQLQVALDAVR TVVERAETPRPFIRELVAVKELAAGDAVVEAAIASINPTAYQRGIPSTTQIFERFRRVAS EVRKASLLPEDAGVASHAASLVLSKVMFKKDALSEGDDVESVLVRTENLLQQGDVDAAAR EMNTLQGWAKILSKDWLGDVRKVLEVRQALEVIEAEARLQCLRVE
Uniprot No.

Target Background

Function

A component of the MICOS complex, a large protein complex within the mitochondrial inner membrane. MICOS plays critical roles in maintaining crista junctions, inner membrane architecture, and the formation of contact sites with the outer membrane. Specifically, this protein helps connect cristae membranes to the inner boundary membrane and facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Formation of Crista Junctions Protein 1 (Fcj1) in Penicillium chrysogenum/rubens?

Fcj1 is a transmembrane protein that functions as a critical component of the MICOS complex (Mitochondrial Contact Site and Cristae Organizing System) . This protein is encoded by the mic60 gene and is also known by several synonyms including "MICOS complex subunit mic60" and "Mitofilin" . The mature protein spans amino acids 62-646, with the full sequence characterized by specific structural motifs that facilitate its function in mitochondrial membrane organization .

The protein plays an essential role in the formation and maintenance of crista junctions, which are the narrow tubular connections between the inner boundary membrane and the cristae membranes of mitochondria. These structures are crucial for maintaining proper mitochondrial morphology and function, including respiratory efficiency and mitochondrial genome maintenance.

Why is Penicillium chrysogenum sometimes referred to as Penicillium rubens in research literature?

Penicillium chrysogenum has been reclassified as Penicillium rubens following taxonomic revisions. This reclassification is particularly evident in strain designations, where you might see "Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum)" used to clarify the identity . The Wisconsin 54-1255 strain has become the standard reference for research on cellular processes in this fungus and was the first to have its genome sequenced .

This taxonomic update reflects improved molecular characterization methods, though many researchers continue to use P. chrysogenum in their publications due to its historical prominence, particularly in the context of penicillin production research.

What expression systems are optimal for producing recombinant Fcj1 protein?

E. coli expression systems have proven effective for the production of recombinant Fcj1 protein for research purposes . The most common approach involves:

  • Gene cloning: The mature protein-coding region (amino acids 62-646) of the mic60 gene is typically cloned into an expression vector with an N-terminal His-tag fusion .

  • Expression conditions: When expressing in E. coli, careful optimization of temperature, inducer concentration, and expression time is essential due to the transmembrane nature of the protein. Lower expression temperatures (16-25°C) may help improve proper folding.

  • Purification strategy: Immobilized metal affinity chromatography (IMAC) using the His-tag is the primary purification method, followed by additional chromatography steps if higher purity is required.

While E. coli is the predominant system, researchers studying the native function might consider homologous expression in Penicillium itself, particularly when investigating interactions with other mitochondrial proteins or when post-translational modifications are critical.

How should recombinant Fcj1 protein be stored to maintain stability?

Optimal storage conditions for recombinant Fcj1 protein include:

  • Long-term storage: The protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt .

  • Working aliquots: For routine experiments, working aliquots can be stored at 4°C for up to one week .

  • Buffer composition: The protein is typically maintained in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . The trehalose serves as a stabilizing agent for the lyophilized protein.

  • Reconstitution: When preparing the protein for use, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Prevention of freeze-thaw damage: Addition of 5-50% glycerol (final concentration) is recommended when storing aliquots for long-term use. The standard final concentration is typically 50% .

  • Avoid repeated freeze-thaw cycles, as they can lead to protein denaturation and aggregation, particularly for membrane proteins like Fcj1 .

What purification methods are most effective for transmembrane proteins like Fcj1?

Purifying transmembrane proteins such as Fcj1 presents unique challenges due to their hydrophobic domains. Effective purification strategies include:

  • Primary purification: For His-tagged recombinant Fcj1, Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or Co-based resins serves as the initial purification step .

  • Detergent considerations: Including appropriate detergents (such as mild non-ionic detergents like DDM or LMNG) in purification buffers is crucial for maintaining protein solubility and preventing aggregation.

  • Buffer optimization: Purification buffers typically contain stabilizing agents like glycerol or trehalose to maintain protein integrity during isolation procedures .

  • Purity assessment: SDS-PAGE analysis is commonly used to verify purity, with recombinant Fcj1 preparations typically achieving >90% purity for research applications .

  • Secondary purification: If higher purity is required, size exclusion chromatography or ion exchange chromatography can be employed as additional purification steps.

How does Fcj1 function within the context of P. chrysogenum/rubens biology?

In P. chrysogenum/rubens, Fcj1 plays critical roles in mitochondrial architecture that may influence several aspects of fungal biology:

  • Respiratory efficiency: As a key component of mitochondrial membrane organization, Fcj1 likely influences the efficiency of the respiratory chain, which is particularly important during certain phases of growth and secondary metabolite production.

  • Metabolic adaptation: The protein may play a role in the fungus's ability to adapt to different carbon sources and growth conditions, as mitochondrial function is closely tied to central metabolism.

  • Secondary metabolism connections: While direct evidence is limited in the search results, mitochondrial function has been implicated in the regulation of secondary metabolite production in filamentous fungi, including penicillin biosynthesis in P. chrysogenum .

  • Cellular stress response: Proper mitochondrial architecture maintained by Fcj1 may contribute to the fungus's ability to respond to various stressors, including oxidative stress.

Research on Fcj1 in P. chrysogenum provides valuable insights into the fundamental biology of this important industrial microorganism, complementing the extensive knowledge gained from studies on penicillin biosynthesis.

How might understanding Fcj1 contribute to knowledge of P. chrysogenum's industrial applications?

P. chrysogenum has been extensively studied for its penicillin production capabilities, and understanding mitochondrial proteins like Fcj1 may provide new perspectives on its industrial applications:

  • Metabolic engineering: Mitochondrial function influences central metabolism, and modulation of Fcj1 could potentially affect energy production and precursor availability for secondary metabolite biosynthesis .

  • Strain improvement considerations: While classical strain improvement programs have focused on enhancing penicillin biosynthesis through various genetic modifications , understanding mitochondrial function could provide new targets for strain optimization.

  • Stress tolerance: Improved mitochondrial function through optimized Fcj1 activity might enhance strain tolerance to industrial fermentation conditions.

  • Synthetic biology applications: P. chrysogenum is increasingly being developed as a cell factory for various compounds beyond penicillin , and mitochondrial engineering could be relevant to these new applications.

  • Bioprocess monitoring: Changes in mitochondrial morphology and function could serve as biomarkers for cellular stress or productivity during industrial fermentation.

What analytical techniques are most informative for studying Fcj1 function in mitochondria?

Several advanced analytical approaches can be employed to investigate Fcj1 function:

  • Electron microscopy: Transmission electron microscopy remains the gold standard for examining mitochondrial ultrastructure and crista morphology in Fcj1 wild-type and mutant strains.

  • Super-resolution microscopy: Techniques such as STED or PALM/STORM microscopy using fluorescently tagged Fcj1 can provide insights into its dynamic localization and interaction with other MICOS components.

  • Biochemical interaction studies: Co-immunoprecipitation, proximity labeling approaches (BioID, APEX), or in vitro reconstitution assays can help identify Fcj1 binding partners and functional interactions.

  • Functional assays: Measurements of mitochondrial membrane potential, respiratory capacity, and ROS production in strains with modified Fcj1 expression can reveal functional consequences of Fcj1 alteration.

  • Omics integration: Combining proteomics, transcriptomics, and metabolomics data can provide a systems-level understanding of how Fcj1 influences cellular functions .

How conserved is Fcj1/Mic60 across fungal species compared to other eukaryotes?

Fcj1/Mic60 shows significant evolutionary conservation across fungi and other eukaryotes, reflecting its fundamental role in mitochondrial architecture:

  • Fungal conservation: The core functional domains of Fcj1 are well-conserved among filamentous fungi, including between P. chrysogenum/rubens and other industrially or medically important fungi.

  • Comparison with model organisms: Homologs of Fcj1/Mic60 exist in model organisms from yeast (Saccharomyces cerevisiae) to humans, though with varying degrees of sequence identity while maintaining functional conservation.

  • Structural conservation: Despite sequence variations, the key structural features - including transmembrane domains and coiled-coil regions - remain conserved across species, suggesting evolutionary pressure to maintain these functional elements.

  • Species-specific adaptations: Comparative genomic analyses might reveal species-specific adaptations in Fcj1 structure that could relate to differences in mitochondrial morphology or metabolism between organisms.

  • Evolutionary implications: The conservation of Fcj1/Mic60 underscores the fundamental importance of crista junction formation in eukaryotic cell biology across evolutionary diverse organisms.

What can be learned from comparing P. chrysogenum Fcj1 with homologous proteins in other fungi?

Comparative analysis of Fcj1 across fungal species can provide valuable insights:

  • Structure-function relationships: Identifying conserved versus variable regions across fungal Fcj1 homologs can highlight domains critical for core functions versus those that may confer species-specific properties.

  • Metabolic correlations: Correlating variations in Fcj1 structure with differences in metabolic capabilities between fungal species could reveal connections between mitochondrial architecture and specialized metabolism.

  • Model organism relevance: Understanding differences between P. chrysogenum Fcj1 and homologs in model organisms like S. cerevisiae can inform the design and interpretation of experiments using these more genetically tractable systems.

  • Industrial applications: Comparing Fcj1 from P. chrysogenum with homologs from other industrial fungi might suggest strategies for mitochondrial engineering to enhance production of various compounds.

  • Evolutionary adaptations: Analysis of Fcj1 across fungi occupying different ecological niches could reveal adaptations related to energy metabolism requirements in these diverse environments.

What are common pitfalls when working with recombinant transmembrane proteins like Fcj1?

Research with recombinant Fcj1 presents several technical challenges:

  • Protein aggregation: The hydrophobic transmembrane domains of Fcj1 can promote aggregation during expression and purification. This can be mitigated by optimizing detergent selection and concentration throughout the purification process.

  • Reduced functional activity: Recombinant expression may result in proteins with compromised functional activity due to improper folding or missing post-translational modifications. Functional assays should be employed to verify activity of purified protein.

  • Variable yield: Expression levels may vary significantly between batches. Standardizing growth conditions and induction parameters can help improve consistency.

  • Storage stability: Membrane proteins like Fcj1 often show reduced stability during storage. The addition of stabilizing agents like trehalose (6%) and glycerol (up to 50%) can help maintain protein integrity .

  • Reconstitution challenges: For functional studies, reconstitution of purified Fcj1 into lipid bilayers or nanodiscs may be necessary but technically challenging, requiring optimization of lipid composition and protein:lipid ratios.

How can researchers optimize the expression of full-length Fcj1 in heterologous systems?

Maximizing the expression and quality of recombinant Fcj1 requires several strategic approaches:

  • Expression construct design:

    • Use of the mature protein sequence (amino acids 62-646) rather than the full-length pre-protein

    • Optimization of codon usage for the expression host

    • Strategic placement of affinity tags (typically N-terminal His-tag for Fcj1)

  • Expression conditions:

    • Reduced temperature (16-25°C) during induction phase

    • Lower inducer concentrations to slow protein production rate

    • Extended expression time to maximize proper folding

    • Consideration of specialized E. coli strains designed for membrane protein expression

  • Cell lysis and extraction:

    • Gentle cell disruption methods to preserve protein structure

    • Immediate addition of appropriate detergents upon lysis

    • Inclusion of protease inhibitors to prevent degradation

  • Quality control:

    • SDS-PAGE analysis to confirm expected molecular weight and purity (>90%)

    • Western blotting to verify identity

    • Size exclusion chromatography to assess oligomeric state and aggregation

How have omics approaches contributed to our understanding of mitochondrial proteins like Fcj1 in P. chrysogenum?

Omics technologies have significantly advanced our understanding of P. chrysogenum biology, with potential implications for mitochondrial proteins like Fcj1:

  • Genomics: The sequencing of multiple P. chrysogenum strains, including the reference strain Wisconsin 54-1255, has provided the foundation for identifying and characterizing genes encoding mitochondrial proteins like Fcj1 .

  • Transcriptomics: Expression studies have helped characterize how various growth conditions and stressors affect the expression of genes related to mitochondrial function, potentially including Fcj1/mic60 .

  • Proteomics: Studies on the P. chrysogenum proteome have helped identify post-translational modifications and protein-protein interactions that influence mitochondrial function .

  • Metabolomics: Metabolite profiling has revealed connections between central metabolism, which is closely tied to mitochondrial function, and secondary metabolism in P. chrysogenum .

  • Integration of multi-omics data: The combined analysis of data from different omics approaches has provided a systems-level understanding of P. chrysogenum metabolism and physiology, which provides context for understanding the role of individual proteins like Fcj1 .

What experimental designs would be most informative for studying Fcj1 function in P. chrysogenum?

Advanced experimental approaches to investigate Fcj1 function could include:

  • CRISPR/Cas9-mediated gene editing:

    • Generation of Fcj1/mic60 knockout or knockdown strains

    • Introduction of point mutations in key functional domains

    • Creation of fluorescently tagged versions for localization studies

  • Comparative phenotypic analysis:

    • Examination of mitochondrial ultrastructure in wildtype versus Fcj1-modified strains

    • Assessment of respiratory capacity and energy metabolism

    • Evaluation of growth characteristics under various stress conditions

    • Analysis of secondary metabolite production in Fcj1 mutants

  • Protein interaction studies:

    • Identification of Fcj1 interaction partners using proximity labeling approaches

    • Validation of interactions using co-immunoprecipitation or split-reporter assays

    • Reconstitution of minimal MICOS complexes in vitro

  • High-resolution structural analysis:

    • Cryo-EM studies of purified Fcj1 or MICOS subcomplexes

    • X-ray crystallography of soluble Fcj1 domains

    • Molecular dynamics simulations based on structural data

  • Integrative omics approaches:

    • Multi-omics profiling of Fcj1 mutant strains

    • Network analysis to identify pathways affected by Fcj1 perturbation

    • Comparison with related industrial strains to identify correlations with productivity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.