Recombinant Penicillium chrysogenum Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; Pc22g17000; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum)
Target Names
get1
Target Protein Sequence
MLSLVLTVFFVHVAIYLVNTIGASTIDSLLWLLYLKLPTPTSRTARKQQQLKRQVLEQKH EMNSTSSQDEFAKWAKARRRHDKSMEEYEALNKTLTAQKSSFDWTVKIARWLSTNGLKIF LQFWYSKTPVFPLPEAWFPYYVEWIVSFPRAPLGSVSIHVWSNVCATTIALTAEVMGALL VQIVGQKKEQRETAPVSAEGKKAQ
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble Get3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the get1 protein in Penicillium chrysogenum and what is its basic function?

The get1 protein (also known as Guided entry of tail-anchored proteins 1) in Penicillium chrysogenum (recently reclassified as Penicillium rubens) is a 204-amino acid transmembrane protein that functions as an essential component of the GET pathway . This evolutionarily conserved pathway is responsible for the post-translational insertion of tail-anchored (TA) membrane proteins into the endoplasmic reticulum (ER) .

Get1 forms a heterodimeric receptor complex with Get2 at the ER membrane. This Get1/2 complex serves as the membrane receptor for the Get3-TA protein complex, facilitating the final insertion step of TA proteins into the ER membrane . The protein contains multiple transmembrane segments and a cytosolic domain that interacts directly with the Get3 ATPase during the TA protein insertion process .

Methodologically, researchers studying get1's basic function typically employ techniques such as:

  • Fluorescence microscopy to visualize protein localization

  • Yeast two-hybrid analysis to detect protein-protein interactions

  • Electrophoretic mobility shift assays (EMSAs) to study DNA-binding properties

  • Gene deletion studies to determine phenotypic effects

How do researchers express and purify recombinant P. chrysogenum get1?

The expression and purification of recombinant P. chrysogenum get1 typically follows this methodological workflow:

  • Cloning and construct design:

    • The get1 coding sequence (1-204aa) is PCR-amplified from P. chrysogenum genomic DNA

    • The sequence is cloned into a suitable expression vector (e.g., pET series) with an N-terminal His-tag for purification

    • Verification by DNA sequencing confirms the correct construct

  • Expression system and conditions:

    • Expression in E. coli is common for recombinant get1 production

    • Bacterial cultures are typically grown to mid-log phase before induction with IPTG

    • Lower temperatures (16-20°C) during induction may enhance proper folding

    • For membrane proteins like get1, specialized E. coli strains (e.g., C41/C43) may improve yields

  • Extraction and purification:

    • Cell lysis under native conditions using sonication or high-pressure homogenization

    • Solubilization of membrane fractions using detergents (e.g., DDM, LDAO)

    • Affinity chromatography using Ni-NTA resin to capture His-tagged protein

    • Size exclusion chromatography for final purification and buffer exchange

  • Quality assessment:

    • SDS-PAGE to assess purity (>90% purity is typically achievable)

    • Western blotting to confirm identity

    • Circular dichroism to verify proper folding

    • Activity assays to confirm functional integrity

Storage recommendations include maintaining the protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles .

How does the get1/get2 complex function mechanistically in the GET pathway?

The get1/get2 complex serves as the membrane receptor for the GET pathway through a sophisticated mechanism involving multiple coordinated steps:

  • Capture of the targeting complex:

    • The cytosolic domains (CDs) of Get1 and Get2 form a complex that enhances their affinity for the Get3- TA targeting complex

    • Get2CD initially captures the Get3- TA complex from the cytosol via long, unstructured regions

  • Conformational remodeling:

    • Both Get1CD and Get2CD contain molecular recognition features (MoRFs) that induce conformational changes in Get3

    • These MoRFs trigger the opening of Get3, which weakens its grip on the TA substrate

    • The cooperative action of both Get1 and Get2 is required for optimal TA release from Get3

  • TA protein insertion:

    • Get1's transmembrane domains form a channel-like structure that facilitates the insertion of the TA protein's transmembrane domain into the ER bilayer

    • The transmembrane segments of Get1/2 are specifically required for insertion, beyond just anchoring the complex to the membrane

  • Recycling:

    • ATP binding to Get3 promotes its release from Get1CD, allowing Get3 to be recycled for another round of TA protein targeting

Experimental evidence for this mechanism comes from:

  • Crosslinking studies showing direct interaction between tail-anchored protein TMDs and Get1

  • Kinetic analyses of intermediate formation during unimpeded integration

  • Site-directed mutagenesis of the Get1/2 transmembrane domains demonstrating their direct role in insertion

This cooperative mechanism explains why both Get1 and Get2 subunits are necessary for efficient TA protein insertion into the ER membrane.

What experimental approaches are used to study get1 function in vivo?

Researchers employ several complementary approaches to investigate get1 function in vivo:

  • Gene deletion and complementation studies:

    • Creation of Δget1 mutants using homologous recombination

    • Phenotypic analysis of mutants under various growth conditions

    • Complementation with wild-type or modified get1 to confirm specificity

    • Expression of get1 under native or constitutive promoters (e.g., gpd promoter)

  • Fluorescence microscopy techniques:

    • GFP-tagged get1 for localization studies

    • DsRed reporter assays to study promoter activity

    • DAPI staining for nuclear co-localization

    • Quantitative fluorescence analysis to measure expression levels

  • Protein-protein interaction studies:

    • Yeast two-hybrid analysis to identify interaction partners

    • Co-immunoprecipitation to confirm direct interactions

    • FRET/BRET to study interactions in living cells

    • Electrophoretic mobility shift assays (EMSAs) to study DNA-binding

  • Functional reporter systems:

    • Heat shock factor transcriptional activity assays to monitor GET pathway disruption

    • GFP cell reporters to measure the effect of get1 mutations

    • Stress response assays to evaluate consequences of GET pathway impairment

  • Transcriptome and proteome analysis:

    • RNA-seq to identify genes affected by get1 deletion

    • ChIP-seq to identify genomic binding sites

    • Proteomics to assess changes in the membrane proteome

    • Targeted RT-PCR to monitor expression of GET pathway components

Table 1: Common phenotypic assays for evaluating get1 function in P. chrysogenum

Assay TypeMethodMeasured ParameterTypical Outcome in Δget1 Mutants
GrowthColony diameter measurementRadial growth rateVariable growth effects
SporulationSpore countingConidiation efficiencyReduced sporulation, especially at elevated temperatures (31°C)
Stress toleranceGrowth under various stressorsTolerance to temperature, oxidative stressReduced tolerance to elevated temperatures
Protein localizationFluorescence microscopyTA protein distributionMislocalization of tail-anchored proteins
Transcriptional changesqRT-PCR or RNA-seqGene expression levelsAltered expression of ER stress response genes

How is get1 expression regulated in P. chrysogenum?

The regulation of get1 expression in P. chrysogenum involves multiple mechanisms:

  • Transcriptional regulation by mating-type loci:

    • The get1 gene (also known as tom1 in some research papers) is directly regulated by the mating-type transcription factor MAT1-1-1

    • ChIP-seq analysis has identified the tom1/get1 gene as one of the major targets of MAT1-1-1, with the highest peak enrichment among the 254 identified target genes

    • The promoter of tom1/get1 contains multiple binding sites for MAT1-1-1, with a consensus motif 'CTATTGAG'

  • Cooperative transcription factor binding:

    • Both MAT1-1-1 and MAT1-2-1 transcription factors can bind to the tom1/get1 promoter in vitro

    • The two transcription factors may form heterodimers to regulate tom1/get1 expression

    • Truncation studies of the promoter showed that the consensus motif alone is not sufficient for activation, suggesting cooperative interactions with other regulatory elements

  • Environmental regulation:

    • Expression may be affected by growth conditions including temperature and light/dark cycles

    • Stress conditions that affect ER function likely influence get1 expression through UPR pathways

  • Developmental regulation:

    • Expression patterns may differ between vegetative growth and sporulation phases

    • Nuclear localization of tom1/get1 was verified by fluorescence microscopy, suggesting a potential role in developmental regulation

Experimentally, researchers investigate get1 regulation through:

  • Reporter gene assays using truncated promoter variants fused to DsRed

  • Electrophoretic mobility shift assays (EMSAs) to analyze transcription factor binding

  • Yeast two-hybrid analysis to study transcription factor interactions

  • Quantitative RT-PCR to measure expression levels under various conditions

What phenotypes are associated with get1 mutations or deletions in P. chrysogenum?

Mutations or deletions in the get1 gene in P. chrysogenum result in several distinct phenotypes:

  • Sporulation defects:

    • Δget1 (Δtom1) deletion strains exhibit reduced conidiation (asexual sporulation)

    • This defect becomes more pronounced at elevated temperatures (31°C)

    • The sporulation phenotype is observable under both light and dark conditions, though light conditions show more significant effects

    • Wild-type phenotype can be partially restored through complementation with the wild-type get1 gene

  • Temperature sensitivity:

    • The growth and development of Δget1 mutants are particularly affected at temperatures above the optimal growth temperature of 27°C

    • At 31°C, the mutants show significantly reduced sporulation compared to control strains

  • TA protein insertion defects:

    • Mutations in the Get1/2 transmembrane domain result in elevated heat shock factor activity, indicating TA protein aggregation in the cytosol

    • Even mutations that preserve the cytosolic domains but alter the transmembrane segments disrupt function

    • Single-chain versions of the Get1/2 heterodimer (Get2-1sc) with mutations in the transmembrane domains fail to complement GET pathway defects

  • Developmental abnormalities:

    • Nuclear localization of get1 suggests potential roles in transcription or nuclear processes

    • Complementation with EGFP-get1 fusion (Δget1::EGFP-get1) only partially restores wild-type phenotypes, suggesting precise expression levels or localization may be important

These phenotypes highlight the importance of get1 in both the GET pathway function for TA protein insertion and potentially in other cellular processes related to development and stress response in P. chrysogenum.

How does P. chrysogenum get1 compare to get1 homologs in other fungi and organisms?

P. chrysogenum get1 shows both conservation and divergence when compared to homologs in other organisms:

  • Sequence conservation:

    • The tom1/get1 gene encodes a protein highly conserved within the Eurotiomycetes fungi

    • Particularly strong conservation is observed among Aspergillus and Penicillium species

    • The 204-amino acid sequence contains conserved transmembrane domains and cytosolic interaction regions

  • Functional conservation:

    • The core GET pathway mechanism appears conserved across eukaryotes from fungi to plants and mammals

    • In all systems, get1 functions as part of a membrane receptor complex for TA protein insertion

    • Cross-species complementation experiments show functional conservation despite sequence divergence

  • Structural divergence:

    • The transmembrane domains show greater sequence divergence than cytosolic domains

    • In mammals, the functional homolog WRB shares the core mechanism but has diverged in sequence

    • Plant GET1 homologs show conservation of function despite sequence differences

  • System complexity variations:

    • In yeast, Get1 and Get2 form a heterodimeric receptor

    • In mammals, WRB (Get1 homolog) and CAML (Get2 homolog) form the receptor

    • In Arabidopsis, the absence of a readily identified GET2 homolog suggests GET1 may serve dual roles

  • Regulatory differences:

    • The regulation by mating-type loci appears specific to certain fungi

    • The connection between sexual development and get1 expression may vary across fungal species

Comparative analysis methods used by researchers include:

  • Phylogenetic analysis of GET pathway components

  • Multiple sequence alignments to identify conserved domains

  • Heterologous expression studies to test functional conservation

  • Comparative genomics to understand regulatory evolution

This evolutionary perspective provides valuable insights into both the conserved core functions and species-specific adaptations of the GET pathway across different organisms.

What methodological approaches are used to study get1's role in the GET pathway biochemically?

Researchers employ several sophisticated biochemical approaches to investigate get1's role in the GET pathway:

  • In vitro reconstitution systems:

    • Cell-free translation systems using yeast extracts to produce radiolabeled TA proteins

    • Purified recombinant Get3, Get4-Get5, and Get1/2 components to reconstitute the pathway

    • Microsomal membrane preparations for insertion assays

    • Glycosylation assays to monitor successful membrane insertion

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with affinity-purified Get3 targeting complexes

    • Crosslinking studies using site-specific crosslinkers to trap intermediates

    • FRET-based approaches to measure real-time interactions

    • Surface plasmon resonance to determine binding kinetics and affinities

  • Structural biology techniques:

    • X-ray crystallography of Get1 cytosolic domains in complex with Get3

    • Cryo-EM to visualize the Get1/2-Get3-TA complex

    • NMR spectroscopy to identify dynamic interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Protein engineering approaches:

    • Creation of single-chain versions of the Get1/2 heterodimer (Get2-1sc)

    • Introduction of cysteine residues for site-specific crosslinking

    • Fusion of reporter tags (e.g., S-protein/S-peptide system) for conformational studies

    • Domain swapping with transmembrane segments from unrelated ER proteins

  • Kinetic and thermodynamic measurements:

    • Real-time monitoring of TA protein insertion using fluorescence

    • Stopped-flow measurements of Get3 conformational changes

    • ATPase activity assays to correlate nucleotide hydrolysis with insertion

    • Titration calorimetry to measure binding energetics

These biochemical approaches collectively provide mechanistic insights into how get1 functions in the capture, remodeling, and insertion of tail-anchored proteins into the ER membrane.

How can CRISPR/Cas9 technology be applied to study get1 function in P. chrysogenum?

CRISPR/Cas9 genome editing offers powerful approaches for investigating get1 function in P. chrysogenum:

  • Precise gene editing strategies:

    • Complete gene deletion to assess null phenotypes

    • Introduction of point mutations to study specific functional domains

    • C-terminal tagging for visualization and purification

    • Promoter replacement to control expression levels

  • Experimental design considerations:

    • Selection of appropriate sgRNA targeting sites (typically in exons)

    • Design of repair templates with homology arms (500-1000 bp)

    • Inclusion of selection markers (e.g., hygromycin resistance)

    • Verification strategies including PCR screening and sequencing

  • Delivery methods for P. chrysogenum:

    • Protoplast transformation using PEG-mediated protocols

    • Agrobacterium-mediated transformation

    • Biolistic transformation for difficult strains

    • Ribonucleoprotein (RNP) complex delivery to reduce off-target effects

  • Advanced applications:

    • CRISPRi for transient gene repression without permanent modification

    • CRISPRa for upregulation of get1 expression

    • Multiplex editing to target get1 alongside interacting partners

    • Base editing for precise nucleotide substitutions without double-strand breaks

  • Phenotypic analysis approaches:

    • High-throughput screening of CRISPR-edited colonies

    • Time-lapse microscopy to observe developmental phenotypes

    • Stress response assays to identify conditional phenotypes

    • Transcriptome analysis of edited strains to identify affected pathways

Table 2: Comparison of gene editing techniques for studying get1 in P. chrysogenum

TechniqueAdvantagesLimitationsEfficiency in P. chrysogenum
CRISPR/Cas9Precise editing, multiplexing capabilityPotential off-target effectsModerate to high with optimization
Homologous recombinationWell-established in P. chrysogenumLabor intensive, lower efficiencyLow to moderate
RNAi knockdownAllows study of essential genesIncomplete silencingVariable efficiency
Transposon mutagenesisRandom insertions for screeningLess precise targetingLow in filamentous fungi

The application of CRISPR/Cas9 technology to study get1 in P. chrysogenum represents an important advancement over traditional methods, allowing more precise and efficient genetic manipulations.

How does get1 function relate to penicillin production in P. chrysogenum?

The relationship between get1 function and penicillin production in P. chrysogenum involves several potential mechanisms:

  • TA protein insertion and secretory pathway:

    • Proper functioning of the GET pathway ensures correct localization of essential TA proteins in the ER

    • Many TA proteins are SNARE proteins involved in vesicle fusion, which are critical for the secretory pathway

    • Efficient secretion is essential for penicillin export from the cell

  • Strain improvement considerations:

    • Industrial penicillin production has relied on classical strain improvement programs

    • Genomic rearrangements that occurred during strain development may have affected GET pathway components

    • Comparative genomics between high-producing strains and wild-type strains might reveal GET pathway adaptations

  • Transcriptional regulation connections:

    • Get1 (tom1) is regulated by mating-type transcription factors MAT1-1-1 and MAT1-2-1

    • These same transcription factors have been shown to influence penicillin production

    • Deletion of MAT1-1-1 significantly reduces penicillin biosynthesis, suggesting a potential regulatory network that includes GET pathway components

  • Environmental stress responses:

    • GET pathway disruption activates stress responses as indicated by heat shock factor activity

    • Stress response pathways are known to influence secondary metabolism including penicillin production

    • Temperature sensitivity of get1 mutants may be relevant to optimizing fermentation conditions

  • Recent findings in extremophilic strains:

    • P. chrysogenum strain 28R-6-F01 from deep coal-bearing sediments produces elevated levels of penicillin (358 μg/mL vs 180 μg/mL in Wisconsin54-1255)

    • This strain has adapted to extreme conditions and shows differences in penicillin biosynthesis gene structure

    • Investigation of GET pathway components in such strains may reveal adaptations relevant to penicillin production

Research approaches to explore this relationship include:

  • Transcriptome comparison between wild-type and get1 mutants under penicillin-producing conditions

  • Quantification of penicillin production in get1 variant strains

  • Analysis of secretory pathway efficiency in GET pathway mutants

  • Characterization of TA protein localization in high-producing strains

What advanced experimental systems can be used to study get1 structure-function relationships?

Several cutting-edge experimental systems provide insights into get1 structure-function relationships:

  • Reconstituted proteoliposome systems:

    • Purified recombinant get1 and get2 can be reconstituted into liposomes

    • These proteoliposomes allow controlled study of membrane insertion

    • Fluorescently labeled TA proteins can be used to measure insertion kinetics

    • Various lipid compositions can be tested to determine optimal membrane environments

  • Cryo-electron microscopy techniques:

    • Single-particle cryo-EM to determine structures of the Get1/2 complex

    • Cryo-electron tomography to visualize GET pathway components in native membranes

    • Time-resolved cryo-EM to capture transient intermediates during insertion

    • Correlative light and electron microscopy to connect function with structure

  • Site-specific crosslinking approaches:

    • Introduction of unnatural amino acids at specific positions within get1

    • Photocrosslinking to capture transient interactions with TA proteins

    • Mass spectrometry analysis of crosslinked peptides to map interaction surfaces

    • In vivo crosslinking to validate interactions in their native context

  • Hydrogen-deuterium exchange mass spectrometry:

    • Mapping conformational changes in get1 upon interaction with partners

    • Identifying flexible regions crucial for function

    • Determining effects of mutations on protein dynamics

    • Elucidating allosteric networks within the protein

  • Advanced fluorescence techniques:

    • Single-molecule FRET to observe conformational changes in real-time

    • Fluorescence correlation spectroscopy to measure binding kinetics

    • Fluorescence recovery after photobleaching (FRAP) to assess membrane mobility

    • Super-resolution microscopy to visualize GET pathway components below the diffraction limit

  • Computational approaches:

    • Molecular dynamics simulations of get1 in membrane environments

    • Protein-protein docking to predict interaction interfaces

    • Deep learning models to predict effects of mutations

    • Systems biology approaches to model GET pathway kinetics

These advanced experimental systems provide complementary insights into how get1's structure relates to its function in tail-anchored protein insertion, enabling researchers to build comprehensive mechanistic models of the GET pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.