Recombinant Penicillium marneffei Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during production. If a particular tag type is required, please specify this in your order for prioritized development.

Synonyms
rcf1-B; aim31; PMAA_094690; Respiratory supercomplex factor 1-B, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei)
Target Names
rcf1-B
Target Protein Sequence
MADQADVLADPDFEEETSIQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNR MFRARIYAQFFTLLAVVAGGMYYKTERKQRREFEKKVEERKAQEKRDAWLRELEARDKED KGWKERHAAVSVTAKKETEGAVDKNVNQAPTEEVVEKRGTGILDAVKALVQGKKD
Uniprot No.

Target Background

Function

Recombinant Penicillium marneffei Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) is a cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Penicillium marneffei and why is it significant in research?

Penicillium marneffei is an emerging pathogenic fungus capable of causing fatal systemic mycosis, particularly in immunocompromised patients such as those with HIV. It was first discovered in 1956 as an infection in bamboo rats but gained recognition as a significant human pathogen during the HIV pandemic in Asia. P. marneffei is endemic to tropical Asian regions including Thailand, northeastern India, China, Hong Kong, Vietnam, and Taiwan, and represents the third most common opportunistic infection in AIDS patients in northern Thailand after tuberculosis and cryptococcosis . The fungus's unique ability to grow as a mycelium at 25°C and transition to a yeast phase at 37°C makes it particularly valuable for studying dimorphic fungi and their pathogenic mechanisms . This temperature-dependent dimorphism is a critical virulence factor that enables its adaptation to different environmental conditions, including the human host environment.

What is the aim31 protein and what role does it play in mitochondrial function?

The Altered inheritance of mitochondria protein 31 (aim31) in Penicillium marneffei is a mitochondrial protein comprising 167 amino acids with a molecular function related to mitochondrial inheritance and maintenance . Based on the amino acid sequence information, aim31 contains specific structural motifs that suggest its involvement in mitochondrial membrane organization and potentially in regulating mitochondrial DNA inheritance patterns. The protein's amino acid sequence (MCSDFEEETSIQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNRMFRARIYAQFFTLLAVVAGGMYYKTERKQRREFEKKVEERKAQEKRDAWLRELEARDKEDKGWKERHAAVSV TAKKETEGAVDKNVNQAPTEEVVEKRGTGILDAVKALVQGKKD) includes regions that may be involved in protein-protein interactions within the mitochondrial membrane structure . Researchers hypothesize that aim31 contributes to the maintenance of mitochondrial membrane integrity and potentially participates in processes related to mitochondrial inheritance during cell division.

How does mitochondrial inheritance typically occur in eukaryotes, and what makes altered inheritance significant?

Altered inheritance patterns, such as those potentially associated with proteins like aim31, are significant because they can fundamentally change our understanding of mitochondrial genetics. In the context of P. marneffei, studying aim31 could provide insights into how this fungal pathogen manages its mitochondrial population during reproduction and infection cycles. The significance extends to better understanding evolutionary pressures that maintain specific inheritance patterns and how alterations might affect organism fitness, pathogenicity, and adaptation to environmental stresses.

What are the optimal methods for expressing and purifying recombinant aim31 protein for functional studies?

Recombinant aim31 protein expression and purification requires a carefully designed experimental approach. Based on current research practices, the following methodological workflow is recommended:

  • Vector Selection and Construct Design:

    • Create an expression construct containing the full aim31 coding sequence (1-167 amino acids) from P. marneffei strain ATCC 18224/CBS 334.59/QM 7333 .

    • Include appropriate fusion tags (His-tag or GST-tag) to facilitate purification while ensuring minimal interference with protein function.

    • Consider codon optimization for the expression host system.

  • Expression System Selection:

    • For structural and functional studies, E. coli BL21(DE3) or Rosetta strains are recommended.

    • For studies requiring post-translational modifications, consider yeast expression systems (Pichia pastoris or Saccharomyces cerevisiae) that better mimic the native fungal environment.

  • Expression Optimization:

    • Test multiple induction conditions: IPTG concentrations (0.1-1.0 mM), induction temperatures (16°C, 25°C, 37°C), and induction duration (4-24 hours).

    • For mitochondrial proteins, lower temperatures (16-25°C) often yield better results by reducing inclusion body formation.

  • Purification Protocol:

    • Employ a two-step purification strategy: affinity chromatography followed by size exclusion chromatography.

    • For aim31, use Tris-based buffers (pH 7.5-8.0) with 50% glycerol for storage as indicated in product specifications .

    • Include reducing agents (DTT or β-mercaptoethanol) to maintain protein stability.

  • Quality Control Assessment:

    • Verify protein purity via SDS-PAGE (>95% purity)

    • Confirm identity through Western blotting and mass spectrometry

    • Assess structural integrity using circular dichroism spectroscopy

This methodological approach is designed to yield high-quality recombinant aim31 protein suitable for downstream functional assays, structural studies, and interaction analyses.

How should researchers design experiments to study the role of aim31 in mitochondrial inheritance in P. marneffei?

Studying the role of aim31 in P. marneffei mitochondrial inheritance requires a multifaceted experimental approach:

  • Gene Knockout/Knockdown Strategy:

    • Generate aim31 deletion mutants using CRISPR-Cas9 or homologous recombination techniques.

    • Create conditional knockdown strains using inducible promoters to study essential functions.

    • Design complementation experiments with wild-type aim31 to verify phenotype specificity.

  • Phenotypic Characterization:

    • Compare growth rates between wild-type and mutant strains at both 25°C (mycelial phase) and 37°C (yeast phase).

    • Assess morphological changes during temperature-induced phase transitions.

    • Evaluate mitochondrial distribution and morphology using fluorescent markers.

  • Mitochondrial DNA Inheritance Analysis:

    • Track mtDNA inheritance patterns through multiple generations using strain-specific mtDNA markers.

    • Apply quantitative PCR to measure relative abundance of specific mtDNA haplotypes in progeny.

    • Implement next-generation sequencing to detect heteroplasmy (mixed mitochondrial populations).

  • Localization and Interaction Studies:

    • Use fluorescent protein fusions to determine aim31 subcellular localization.

    • Perform co-immunoprecipitation experiments to identify protein interaction partners.

    • Apply proximity labeling techniques (BioID or APEX) to map the protein's interaction network within mitochondria.

  • Functional Assays:

    • Measure mitochondrial membrane potential in wild-type versus mutant strains.

    • Assess respiratory chain activity under various growth conditions.

    • Evaluate response to oxidative stress agents that specifically target mitochondria.

By systematically implementing these methodological approaches, researchers can establish the specific contributions of aim31 to mitochondrial inheritance and function in P. marneffei, potentially revealing mechanisms that differ from or parallel those observed in the recently documented cases of biparental mitochondrial inheritance in humans .

What controls and validation techniques are essential when studying recombinant aim31 protein activity?

When studying recombinant aim31 protein activity, implementing rigorous controls and validation techniques is crucial for generating reliable and reproducible results:

  • Essential Controls:

    • Positive Controls: Include known mitochondrial proteins with established functions in similar assays.

    • Negative Controls: Use unrelated proteins with similar size/structure but different functions.

    • Enzymatic Dead Mutants: Engineer point mutations in predicted functional domains of aim31 to serve as function-specific negative controls.

    • Host Background Controls: Ensure the expression system doesn't contribute to observed activities by running parallel experiments with host cells containing empty vectors.

  • Protein Validation Techniques:

    • Activity Assays: Verify functionality through substrate-specific biochemical assays.

    • Thermal Shift Assays: Confirm proper protein folding and stability under experimental conditions.

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Assess oligomeric state and homogeneity.

    • Native PAGE: Evaluate the protein's quaternary structure and complex formation capacity.

  • Interaction Validation Methods:

    • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC): Quantify binding affinities with potential interaction partners.

    • Microscale Thermophoresis: Measure interactions under near-native conditions.

    • Crosslinking Mass Spectrometry: Identify precise interaction interfaces.

    • Yeast Two-Hybrid or Mammalian Two-Hybrid Assays: Verify interactions in cellular contexts.

  • Functional Validation Approaches:

    • Complementation Assays: Test if recombinant aim31 can rescue phenotypes in aim31-deficient cells.

    • Domain Swapping Experiments: Replace functional domains with corresponding regions from related proteins to confirm domain-specific activities.

    • In vitro Reconstitution: Reconstruct minimal systems with purified components to directly test molecular functions.

  • Technical Validations:

    • Batch-to-Batch Consistency: Verify reproducibility across different protein preparations.

    • Storage Stability Tests: Confirm activity retention after various storage conditions and freeze-thaw cycles as recommended in product specifications .

    • Concentration-Dependent Activity Profiling: Ensure linear response within the working concentration range.

How should researchers analyze and interpret heteroplasmy data when studying mitochondrial inheritance patterns?

Analyzing heteroplasmy data in mitochondrial inheritance studies requires sophisticated approaches that account for the complexity of mixed mitochondrial populations:

  • Quantification Methodologies:

    • Next-Generation Sequencing (NGS): The gold standard for heteroplasmy detection, allowing detection of variants present at levels as low as 1-2%.

    • Digital Droplet PCR (ddPCR): Provides absolute quantification of specific heteroplasmic variants with high precision.

    • Pyrosequencing: Offers medium-throughput quantification with approximately 5% detection sensitivity.

    • Real-time PCR: Suitable for targeted analysis of known heteroplasmic sites.

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests based on experimental design (paired vs. unpaired comparisons).

    • Implement Bayesian methods to account for sequencing errors and technical variations.

    • Use hierarchical clustering to identify patterns of co-segregating mitochondrial variants.

    • Consider linear mixed models when analyzing family pedigrees with multiple generations.

  • Interpretation Guidelines:

    • Establish clear thresholds for distinguishing true heteroplasmy from technical artifacts (typically 1-3% depending on methodology).

    • Compare heteroplasmy patterns across tissues within the same individual to identify tissue-specific segregation.

    • Track heteroplasmy levels across generations to calculate the "mitochondrial bottleneck" effect.

    • Analyze parent-offspring transmission to identify potential biparental inheritance patterns.

  • Heteroplasmy Data Visualization:

    • Create heat maps displaying heteroplasmy levels across samples and conditions.

    • Develop circular plots representing the mitochondrial genome with heteroplasmic positions highlighted.

    • Use phylogenetic networks rather than traditional trees when analyzing mixed mitochondrial populations.

  • Integration with Nuclear Genetic Data:

    • Correlate heteroplasmy patterns with nuclear genotypes, particularly for genes involved in mitochondrial maintenance.

    • Perform nuclear-mitochondrial interaction analyses to identify potential genetic modifiers of heteroplasmy.

The analysis of human cases with biparental mitochondrial inheritance provides a valuable framework for understanding altered inheritance patterns . In these cases, researchers observed distinct heteroplasmy patterns with approximately 40-60% heteroplasmy levels that remained relatively stable across generations, suggesting the existence of nuclear factors that regulate this process. When studying aim31's potential role in P. marneffei mitochondrial inheritance, researchers should apply similar analytical approaches to identify whether this protein contributes to normal uniparental inheritance or enables alternative inheritance patterns.

What statistical approaches and experimental designs are most appropriate for evaluating aim31 function in varying environmental conditions?

To rigorously evaluate aim31 function across environmental conditions, researchers should implement robust statistical approaches and experimental designs that maximize data reliability while minimizing confounding factors:

How can researchers address contradictory findings in aim31 functional studies?

Addressing contradictory findings in aim31 functional studies requires systematic investigation of potential sources of discrepancy and implementation of reconciliation strategies:

  • Systematic Analysis of Contradictions:

    • Create a comprehensive comparison table documenting contradictory results across studies.

    • Categorize discrepancies by type: methodological differences, context-dependent effects, or fundamental contradictions.

    • Identify patterns in contradictions that might reveal underlying biological complexity rather than experimental error.

  • Methodological Reconciliation Strategies:

    • Cross-Laboratory Validation: Establish collaborative projects where multiple labs perform identical experiments using standardized protocols.

    • Method Triangulation: Apply multiple independent techniques to measure the same parameter, increasing confidence when consistent results emerge.

    • Blind Analysis: Implement blinded experimental design and data analysis to minimize confirmation bias.

    • Material Exchange: Share key reagents (plasmids, strains, antibodies) between labs reporting contradictory results.

  • Biological Context Exploration:

    • Investigate strain-specific differences that might explain varying results.

    • Systematically test environmental conditions that might reveal context-dependent functions.

    • Consider genetic background effects, particularly nuclear genes that might interact with aim31.

    • Examine life-cycle stage specificity that could explain temporal differences in function.

  • Technical Sources of Contradiction:

    • Protein Tagging Effects: Test whether different fusion tags alter aim31 functionality.

    • Expression Level Artifacts: Determine if overexpression produces phenotypes not observed at physiological levels.

    • Isoform Specificity: Verify whether contradictions arise from studying different protein isoforms.

    • Post-translational Modifications: Examine whether different experimental conditions alter protein modifications and thus function.

  • Meta-Analysis and Computational Approaches:

    • Apply formal meta-analysis techniques to quantitatively integrate results across studies.

    • Use machine learning to identify variables that predict when certain functional outcomes will occur.

    • Develop computational models that can accommodate apparently contradictory data by incorporating additional parameters.

An instructive framework comes from studies of mitochondrial inheritance in humans, where researchers initially faced contradictory evidence regarding biparental inheritance. The resolution came through rigorous validation across multiple unrelated families and independent sequencing in different laboratories using various methodologies . Similarly, when facing contradictions in aim31 functional studies, researchers should implement multiple validation approaches while considering that apparent contradictions might reflect complex biological regulation rather than experimental error.

How might aim31 function interface with host-pathogen interactions during P. marneffei infection?

The potential role of aim31 in host-pathogen interactions during P. marneffei infection represents an important frontier in understanding this fungal pathogen's virulence mechanisms:

  • Mitochondrial Adaptation During Infection:

    • aim31 may facilitate mitochondrial remodeling during the temperature-induced morphological transition from mold (25°C) to yeast (37°C) that occurs during host invasion .

    • The protein could participate in metabolic reprogramming needed to survive the nutrient-limited environment inside macrophages.

    • aim31-mediated mitochondrial adaptations might contribute to resistance against host-derived reactive oxygen species and nitric oxide, which are key antimicrobial mechanisms employed by activated macrophages .

  • Potential Immunomodulatory Effects:

    • Mitochondrial components, including those potentially regulated by aim31, could serve as pathogen-associated molecular patterns (PAMPs) recognized by host immune receptors.

    • aim31 might indirectly influence the balance between protective Th1 responses (characterized by IL-12, IFN-γ, and TNF-α) and non-protective responses during P. marneffei infection .

    • The protein could potentially affect osteopontin (OPN) production, which has been implicated in regulating immune responses to P. marneffei through polarization of Th1 cytokine responses .

  • Mitochondrial Dynamics During Intracellular Survival:

    • aim31 may contribute to mitochondrial fission-fusion dynamics needed for fungal survival inside phagocytes.

    • The protein could participate in maintaining mitochondrial DNA integrity under host-induced stress conditions.

    • aim31-mediated processes might influence energy production required for intracellular replication within macrophages.

  • Research Methodologies to Explore This Interface:

    • Generate fluorescently tagged aim31 to track its localization during macrophage infection using live-cell imaging.

    • Develop aim31 knockout and conditional knockdown strains to assess virulence in macrophage infection models and animal models.

    • Apply transcriptomic and proteomic approaches to compare wild-type and aim31-deficient strains during host cell infection.

    • Implement metabolomic profiling to identify aim31-dependent metabolic adaptations during host interaction.

  • Translational Research Directions:

    • Evaluate aim31 as a potential biomarker for diagnostic applications in P. marneffei infection.

    • Assess whether aim31 or its associated pathways represent novel therapeutic targets for antifungal development.

    • Investigate whether aim31-specific antibodies develop during natural infection and could serve as serological markers.

Understanding the interface between aim31 function and host-pathogen interactions could provide valuable insights into the molecular mechanisms underlying P. marneffei pathogenesis, potentially revealing new approaches for diagnosis and treatment of this emerging fungal infection.

What are the most promising techniques for studying the structural biology of aim31 and its interactions with other mitochondrial proteins?

Elucidating the structural biology of aim31 and its protein interaction network requires application of cutting-edge structural biology approaches:

  • High-Resolution Structure Determination:

    • X-ray Crystallography: Offers atomic-level resolution but requires successful crystallization.

      • Optimization strategy: Screen multiple constructs with varying terminal truncations to improve crystallization propensity.

      • Consider surface entropy reduction mutations to enhance crystal packing.

    • Cryo-Electron Microscopy (Cryo-EM): Particularly valuable for membrane-associated proteins like aim31.

      • Single-particle analysis for isolated protein complexes.

      • Subtomogram averaging for in situ structural studies within mitochondrial membranes.

    • Nuclear Magnetic Resonance (NMR) Spectroscopy: Suitable for dynamic regions and smaller domains of aim31.

      • Focus on solution dynamics that may be critical for function.

      • Implement selective isotope labeling to study specific regions.

  • Integrative Structural Biology Approaches:

    • Small-Angle X-ray Scattering (SAXS): Provides low-resolution envelope information in solution.

    • Cross-linking Mass Spectrometry (XL-MS): Maps protein-protein interaction interfaces.

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies dynamic regions and ligand-binding sites.

    • Integrative Modeling: Combines data from multiple experimental sources to generate comprehensive structural models.

  • Membrane Protein-Specific Methods:

    • Lipid Nanodiscs: Reconstruct aim31 in native-like membrane environments for structural studies.

    • Detergent Screening: Systematically evaluate detergents that maintain native structure and function.

    • Styrene Maleic Acid Lipid Particles (SMALPs): Extract membrane protein complexes with surrounding lipid environment intact.

  • Protein Interaction Network Mapping:

    • Proximity Labeling (BioID, APEX): Identify neighboring proteins in the native mitochondrial environment.

    • Co-evolution Analysis: Use sequence conservation patterns to predict interacting partners.

    • Protein Complementation Assays: Verify direct interactions in cellular contexts.

    • Native Mass Spectrometry: Characterize intact protein complexes and their stoichiometry.

  • Dynamic Structural Analysis:

    • Molecular Dynamics Simulations: Model aim31 behavior in membrane environments over time.

    • Hydrogen-Deuterium Exchange (HDX): Map conformational changes upon binding partners or ligands.

    • Single-Molecule FRET: Track conformational changes in real-time at the single-molecule level.

    • Time-resolved structural methods: Capture transient conformational states during function.

The structural characterization of aim31 should be integrated with functional studies to establish structure-function relationships. This integrated approach will be particularly valuable for understanding aim31's potential role in mitochondrial inheritance, which may have parallels to mechanisms involved in the recently discovered biparental inheritance of mitochondrial DNA in humans .

How might computational modeling and systems biology approaches advance our understanding of aim31's role in mitochondrial networks?

Computational modeling and systems biology offer powerful approaches to understand aim31's function within the complex mitochondrial network:

  • Protein Structure Prediction and Molecular Modeling:

    • Apply AlphaFold2 or RoseTTAFold to predict aim31's three-dimensional structure based on its amino acid sequence .

    • Perform molecular dynamics simulations to understand aim31's behavior in membrane environments.

    • Model protein-protein docking to predict interactions with other mitochondrial components.

    • Conduct virtual screening to identify potential small-molecule modulators of aim31 function.

  • Network Modeling Approaches:

    • Construct protein-protein interaction networks centered on aim31 using both experimental data and computational predictions.

    • Develop Bayesian networks to infer causal relationships between aim31 and other mitochondrial processes.

    • Apply flux balance analysis to model metabolic changes resulting from aim31 perturbation.

    • Create dynamic models of mitochondrial inheritance incorporating aim31 function.

  • Multi-scale Modeling Frameworks:

    • Integrate molecular, cellular, and population-level models to understand aim31's impact across biological scales.

    • Develop agent-based models of mitochondrial dynamics during cell division.

    • Implement stochastic modeling to capture heterogeneity in mitochondrial behavior.

    • Create whole-cell models incorporating aim31 function within broader cellular contexts.

  • Machine Learning Applications:

    • Apply supervised learning to predict aim31 functional partners from genomic and proteomic data.

    • Use unsupervised learning to identify patterns in high-dimensional experimental data related to aim31 function.

    • Implement deep learning approaches to predict phenotypic outcomes of aim31 mutations.

    • Develop reinforcement learning algorithms to optimize experimental design for aim31 characterization.

  • Integrative Systems Biology Framework:

    Data TypeComputational ApproachExpected Insights
    TranscriptomicDifferential expression analysis, Gene set enrichmentaim31-dependent gene expression changes, affected pathways
    ProteomicProtein correlation profiling, Network analysisaim31 protein complexes, post-translational regulation
    MetabolomicMetabolic flux analysis, Pathway enrichmentaim31's impact on mitochondrial metabolism
    Genetic interactionEpistasis mapping, Synthetic lethality predictionFunctional relationships with other genes
    EvolutionaryComparative genomics, Phylogenetic analysisConservation patterns, evolutionary constraints
  • Experimental Design Optimization:

    • Apply principles from experimental design for data analysis to optimize aim31 research.

    • Implement Bayesian experimental design to maximize information gain from each experiment.

    • Develop active learning approaches that iteratively refine models of aim31 function.

    • Create hypothesis testing frameworks that systematically evaluate competing models.

By integrating these computational and systems biology approaches, researchers can develop comprehensive models of aim31 function within mitochondrial networks. These models can generate testable hypotheses about aim31's role in processes like mitochondrial inheritance, potentially revealing mechanisms similar to those involved in the newly discovered biparental inheritance of mitochondrial DNA in humans .

How might understanding aim31 function contribute to developing novel antifungal strategies against P. marneffei infections?

Understanding aim31 function could open new avenues for antifungal development against P. marneffei, particularly for immunocompromised patients with severe infections:

  • Target Validation Framework:

    • Evaluate aim31 essentiality using conditional knockdown systems in vitro and in vivo.

    • Determine whether aim31 disruption affects P. marneffei pathogenicity in macrophage and animal infection models.

    • Assess whether aim31 functions are sufficiently distinct from human mitochondrial proteins to enable selective targeting.

    • Investigate whether aim31 is required during the clinically relevant yeast phase at 37°C in human hosts .

  • Therapeutic Development Approaches:

    • Structure-Based Drug Design: Utilize structural information about aim31 to identify druggable pockets for small molecule inhibitor development.

    • Peptide-Based Inhibitors: Design peptides that disrupt specific aim31 interactions with other mitochondrial components.

    • RNA Interference Strategies: Develop fungal-specific siRNA delivery systems targeting aim31 expression.

    • PROTAC Approach: Create proteolysis-targeting chimeras to selectively degrade aim31 protein.

  • Combination Therapy Strategies:

    • Test aim31-targeting compounds with established antifungals like amphotericin B and itraconazole, which are currently used to treat P. marneffei infections .

    • Investigate potential synergistic effects between aim31 inhibitors and host immune modulators.

    • Explore combinations targeting multiple mitochondrial functions to prevent resistance development.

  • Biomarker Applications:

    • Evaluate whether aim31 or its metabolic products could serve as diagnostic biomarkers for P. marneffei infection.

    • Develop assays to monitor treatment efficacy based on aim31-related metabolites or functions.

    • Investigate whether anti-aim31 antibodies develop during infection and could be used for serological diagnosis.

  • Translational Research Considerations:

    • Address drug delivery challenges, particularly for compounds targeting mitochondrial proteins.

    • Develop appropriate animal models that recapitulate human P. marneffei infection for preclinical testing.

    • Consider specific formulations for immunocompromised populations, particularly HIV/AIDS patients who represent the primary at-risk group .

The development of aim31-targeted antifungal strategies would be particularly valuable given the limited arsenal of antifungal drugs currently available and the serious nature of P. marneffei infections in immunocompromised hosts. Since current treatment relies primarily on amphotericin B and itraconazole , novel mitochondria-targeting approaches could provide much-needed therapeutic alternatives, especially for drug-resistant cases.

What research methodologies would best demonstrate the potential evolutionary significance of altered mitochondrial inheritance patterns in P. marneffei?

Investigating the evolutionary significance of altered mitochondrial inheritance patterns in P. marneffei requires sophisticated methodologies spanning multiple disciplines:

  • Comparative Genomics Approaches:

    • Sequence and compare aim31 orthologs across diverse fungal lineages, including pathogenic and non-pathogenic species.

    • Apply molecular evolution tests (Ka/Ks ratios, McDonald-Kreitman tests) to detect signatures of selection on aim31.

    • Conduct synteny analysis to examine chromosomal context conservation around aim31 genes.

    • Implement ancestral sequence reconstruction to trace the evolutionary history of aim31.

  • Population Genetics Methodologies:

    • Sample P. marneffei isolates from diverse geographic regions to assess aim31 variation.

    • Evaluate mitochondrial haplotype diversity and distribution across populations.

    • Test for evidence of selective sweeps or balancing selection on mitochondrial genomes.

    • Apply coalescent modeling to reconstruct historical population dynamics and selection events.

  • Experimental Evolution Frameworks:

    • Subject P. marneffei to long-term evolution experiments under varying selective pressures.

    • Track changes in mitochondrial inheritance patterns and aim31 sequence/expression over generations.

    • Apply whole-genome sequencing to identify compensatory mutations that arise in response to altered inheritance.

    • Implement competition assays between strains with different inheritance patterns to assess fitness effects.

  • Phylogenetic Comparative Methods:

    • Construct robust phylogenies incorporating both nuclear and mitochondrial markers.

    • Apply trait evolution models to map changes in inheritance patterns across evolutionary history.

    • Test for correlated evolution between inheritance patterns and other traits (pathogenicity, host range, etc.).

    • Implement ancestral state reconstruction to identify transitions in inheritance mechanisms.

  • Cross-Species Functional Analysis:

    • Test functional complementation of aim31 orthologs across species boundaries.

    • Perform domain swapping experiments to identify regions responsible for species-specific functions.

    • Create chimeric proteins to pinpoint evolutionarily significant domains.

    • Analyze co-evolution between aim31 and interacting partners.

The evolutionary significance of altered mitochondrial inheritance could be particularly revealing when compared to the recently discovered biparental inheritance of mitochondrial DNA in humans . This comparison might reveal whether similar mechanisms evolved independently across distantly related eukaryotes, suggesting convergent evolution, or whether distinct mechanisms evolved to solve similar biological challenges. Such research could fundamentally change our understanding of mitochondrial inheritance evolution across the eukaryotic tree of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.