Recombinant Penicillium marneffei Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mic60; PMAA_094570; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-643
Protein Length
Full Length of Mature Protein
Species
Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei)
Target Names
mic60
Target Protein Sequence
ADHKNVPPTSPTPVSPESQSVIPPQTVNPVTATPTAQVQTSPPSSIQPPKPPVETPSSSP IPPPTPKKTGRFRRFLLYLILTSGIAYGGGVFLALKSDNFHDFFTEYVPYGEESVLYFEE RDFYRRFPNATRHSNRLPPIHKEQSQRVTIPSKSGLSWKVSEEESDSASLTQKGPHNSAV DASKDASAVKTVIKAKEESAEKKAPVKKEAAPPAPKEEPRTPAIATPATLELIKVEGADE PVVQELVRIFNDIITVIGADEGAATKYAAPVSRVRTEVETIGQKISSLRADAEKAAKEEV EKAHALFDESAKKLMQQIEQARAAEAAQFREEFEAEREKLVRAYQEKIQTELSRAQELAE QRLKNELVEQAIELNRKYLNDVKELVERERDGRLSKISELTANVNQLEKLTTDWSDVIES NLKTQQLQVAVDAVRSVLEGATSAKPFIRELVAVKELAADDPVVAAAIASINPTAYQRGI PTSSQLIERFRRVAGEVRKASLLPEDAGIASHAASFVLSKVMFKRDAVTDGDDVESVLVR TENLLEEGNLDAAAREMNTLQGWAKILSKDWLADVRRVLEVKQAVELMETEARLQCLRVE S
Uniprot No.

Target Background

Function

Recombinant Penicillium marneffei Formation of Crista Junctions protein 1 (fcj1) is a component of the mitochondrial inner membrane MICOS complex. This large protein complex plays essential roles in maintaining crista junctions, inner membrane architecture, and forming contact sites with the outer membrane. fcj1 contributes to the connection between cristae membranes and the inner boundary membrane and facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its functional significance in mitochondrial architecture?

Fcj1 (Formation of crista junctions protein 1), known as mitofilin in mammals, is a mitochondrial inner membrane protein that plays a crucial role in the formation and maintenance of crista junctions (CJs). CJs are tubular invaginations of the inner membrane that connect the inner boundary with the cristae membrane . Functionally, Fcj1 is essential for proper mitochondrial architecture and function.

The protein is preferentially located at CJs and participates in an antagonistic relationship with subunits e and g of the F1F0 ATP synthase to modulate CJ formation. Research has established that Fcj1 influences the oligomerization state of the F1F0 ATP synthase, which directly affects cristae structure .

Fcj1 has been identified as a core component of a larger multisubunit complex called MICOS (mitochondrial contact site and cristae organizing system), which plays a central role in maintaining the proper architecture of the mitochondrial inner membrane . This protein-complex association is fundamental to understanding how mitochondrial membrane architecture is regulated at the molecular level.

What are the critical structural domains of Fcj1 and their specific functions?

Fcj1 contains several distinct domains with different functional roles:

  • C-terminal domain: The most conserved part of Fcj1, essential for its function. Studies show that in the absence of this domain, CJ formation is strongly impaired and irregular, with stacked cristae appearing in the mitochondria . This domain:

    • Interacts with full-length Fcj1, suggesting a role in oligomer formation

    • Interacts with Tob55 of the TOB/SAM complex

    • Is required for stabilizing CJs close to the outer membrane

  • Coiled-coil domain: Located in the central portion of the protein (amino acids 144-341 in yeast). Deletion of this domain moderately impairs function, showing an intermediate phenotype between wild-type and complete absence of Fcj1 .

  • Transmembrane domain: Anchors the protein in the inner mitochondrial membrane.

Experimental data using deletion constructs has demonstrated that the C-terminal domain is particularly critical - its deletion produces phenotypes similar to complete Fcj1 deletion, while coiled-coil domain deletion shows less severe effects .

What methodological approaches can be used to study P. marneffei Fcj1 domain functions?

To effectively study the domain functions of P. marneffei Fcj1, researchers can employ several sophisticated methodological approaches:

Domain Deletion and Mutation Analysis:

  • C-terminal tagging and domain deletion constructs: Generate constructs with Protein A tags and various domain deletions (similar to the approach used in yeast studies). For example:

    • Fcj1-ΔC (lacking the C-terminal domain)

    • Fcj1-Δcc (lacking the coiled-coil domain)

    • Fcj1-ΔN (lacking the N-terminal domain)

  • Site-directed mutagenesis: Target conserved residues within each domain to identify critical amino acids without removing entire domains

Functional Assessment Approaches:

  • Growth phenotype analysis: Analyze colony morphology, growth rates on different carbon sources at varying temperatures (30°C vs. 37°C)

  • Microscopy techniques:

    • Electron microscopy with diaminobenzidine staining to visualize mitochondrial ultrastructure

    • Fluorescence microscopy with tagged Fcj1 variants to assess localization patterns

Biochemical and Interaction Studies:

  • Co-immunoprecipitation assays: Identify interaction partners of different Fcj1 domains

  • Blue native PAGE: Assess incorporation of Fcj1 variants into MICOS complex

  • Crosslinking experiments: Capture transient interactions with other mitochondrial proteins

Heterologous Expression Systems:

  • Express P. marneffei Fcj1 in S. cerevisiae fcj1Δ strains to assess functional complementation

  • Compare growth and mitochondrial morphology phenotypes between temperatures

This multi-faceted approach would allow comprehensive characterization of domain-specific functions while accounting for the temperature-dependent dimorphic nature of P. marneffei .

How might the MICOS complex composition differ in P. marneffei compared to model organisms?

The MICOS complex in P. marneffei likely shows both conserved and species-specific features compared to well-studied model organisms. Based on comparative analysis:

Predicted MICOS Composition in P. marneffei:

SubunitKnown function in model systemsP. marneffei homolog statusPotential uniqueness
Fcj1/Mic60Core component, interacts with TOB/SAM complexPresent (sequence identified) May contain adaptations for thermotolerance
Mic10Critical for cristae junction formationLikely present (predicted)May show altered expression during dimorphic transition
Mic19Links Mic60 to Mic10 subcomplexesProbable homolog existsPotentially modified interface domains
Mic26/Mic27Membrane curvature and stabilityPrediction neededMay have specialized lipid interaction domains
Mic12Connecting subunitPrediction neededCould have divergent sequences

Research indicates that while the core MICOS components are likely conserved in P. marneffei, their regulation might differ significantly, especially considering the organism's dimorphic nature. The temperature-dependent morphological transition from mold to yeast form (at 37°C) likely involves remodeling of mitochondrial architecture .

The MICOS complex in P. marneffei may have evolved specialized features to:

  • Accommodate rapid mitochondrial remodeling during temperature-induced morphological transitions

  • Function optimally at both environmental and host body temperatures

  • Potentially contribute to virulence mechanisms through altered mitochondrial function

To experimentally determine the MICOS composition in P. marneffei, researchers should consider immunoprecipitation of tagged Fcj1 followed by mass spectrometry analysis under both mold-inducing and yeast-inducing conditions to capture temperature-dependent changes in complex composition .

How do mutations in P. marneffei Fcj1 affect mitochondrial ultrastructure and function?

Mutations in P. marneffei Fcj1 would likely produce significant alterations in mitochondrial ultrastructure and function, similar to but potentially distinct from those observed in model organisms. Based on studies in yeast and other systems:

Expected Ultrastructural Changes:

  • Loss of Crista Junctions: Complete loss or deletion of the C-terminal domain of Fcj1 would likely result in severe reduction or absence of crista junctions, as observed in S. cerevisiae .

  • Abnormal Cristae Morphology: Expect formation of stacked, lamellar cristae membranes instead of the normal tubular invaginations, leading to increased inner membrane surface area .

  • Altered Mitochondrial Network: Possible fragmentation or condensation of the mitochondrial network, with both elongated tubular segments and fragmented structures potentially coexisting .

Functional Consequences:

  • Respiratory Deficiency: Defects in cristae architecture would likely impair respiratory chain complex organization and function .

  • Growth Defects: Particularly pronounced when grown on non-fermentable carbon sources that require mitochondrial respiration .

  • Temperature-Dependent Effects: Given P. marneffei's dimorphic nature, Fcj1 mutations might show more severe phenotypes at either environmental temperatures or at 37°C, depending on the specific domain affected.

Domain-Specific Effects:
Based on studies in yeast models , different Fcj1 domains would produce distinct phenotypes if mutated:

  • C-terminal domain mutations: Most severe effects, comparable to complete Fcj1 deletion

  • Coiled-coil domain mutations: Intermediate phenotype with partially preserved function

  • N-terminal domain mutations: Potentially affecting membrane anchoring and localization

Experimental Approach to Study These Effects:
Combine electron microscopy, growth assays on different carbon sources at varying temperatures, and functional respiratory measurements using oxygen consumption assays. Correlate ultrastructural changes with specific molecular defects through complementation studies with wild-type and mutant Fcj1 variants .

What roles might P. marneffei Fcj1 play in adaptation to environmental stresses?

P. marneffei Fcj1 likely plays crucial roles in the organism's adaptation to various environmental stresses, particularly those encountered during its complex lifecycle between environmental reservoirs and mammalian hosts.

Thermal Stress Adaptation:
As a thermally dimorphic fungus, P. marneffei must adapt to significant temperature changes (from soil temperatures to 37°C in mammalian hosts). Mitochondrial architecture remodeling is likely essential for this adaptation . Fcj1, as a key determinant of cristae structure, may facilitate:

  • Energy production optimization at different temperatures

  • Respiratory chain reorganization during thermal transitions

  • Maintenance of mitochondrial integrity during morphological switching

Oxidative Stress Responses:
During host infection, P. marneffei encounters reactive oxygen species (ROS) generated by immune cells. Proper cristae architecture maintained by Fcj1 may support:

  • Compartmentalization of ROS-producing respiratory complexes

  • Protection of mitochondrial DNA from oxidative damage

  • Coordination with antioxidant systems like catalase-peroxidase (which is upregulated in yeast phase)

Nutrient Adaptation:
P. marneffei transitions between nutrient-rich culture media, soil environments, and the restrictive environment within macrophages. Fcj1-mediated mitochondrial architecture may facilitate:

  • Metabolic flexibility through cristae remodeling

  • Efficient ATP production under nutrient limitation

  • Integration with metabolic pathways that allow utilization of host-derived nutrients

pH and Osmotic Stress:
The fungus must adapt to varying pH and osmotic conditions in different environments. Mitochondrial responses coordinated through Fcj1 could include:

  • Maintenance of ion homeostasis via proper compartmentalization

  • Coordination with cytosolic stress response pathways

  • Mitochondrial volume regulation during osmotic challenges

Experimental Approaches to Study These Roles:

  • Compare expression and localization of Fcj1 under various stress conditions

  • Analyze mitochondrial ultrastructure during exposure to different stressors

  • Generate conditional Fcj1 mutants and assess their stress tolerance profiles

  • Identify stress-specific interaction partners of Fcj1 through proteomics approaches

Understanding these adaptations could provide insights into both basic mitochondrial biology and the pathogenesis mechanisms of this important opportunistic pathogen .

What approaches can be used to express and purify recombinant P. marneffei Fcj1 for structural and functional studies?

Expressing and purifying recombinant P. marneffei Fcj1 presents several challenges due to its membrane-associated nature and complex domain structure. Here are comprehensive approaches to overcome these challenges:

Expression Systems:

  • E. coli-based expression:

    • For soluble domains (particularly the C-terminal domain)

    • Use specialized strains like BL21(DE3) Rosetta for rare codon optimization

    • Consider fusion tags such as MBP, GST, or SUMO to enhance solubility

    • Expression at lower temperatures (16-18°C) to improve folding

  • Yeast expression systems:

    • S. cerevisiae fcj1Δ strains for functional complementation studies

    • P. pastoris for higher yields of membrane proteins

    • Use inducible promoters (GAL1 in S. cerevisiae, AOX1 in P. pastoris)

  • Mammalian cell expression:

    • HEK293 or CHO cells for complex eukaryotic post-translational modifications

    • Especially valuable for interaction studies with mammalian partners

Purification Strategies for Full-length Fcj1:

  • Membrane protein extraction:

    • Two-phase detergent solubilization (digitonin followed by DDM or LMNG)

    • Evaluate detergent screening panels to identify optimal solubilization conditions

    • Consider native nanodiscs or amphipols for maintaining native-like environment

  • Chromatography approaches:

    • Initial IMAC purification using His-tagged constructs

    • Size exclusion chromatography to isolate properly folded oligomeric states

    • Ion exchange chromatography as a polishing step

Domain-based Approach:

For structural studies, a domain-based approach may be more successful:

DomainResiduesExpression SystemPurification Strategy
C-terminal domain~492-540E. coli with GST tagGST affinity followed by SEC
Coiled-coil domain~144-341E. coli with His-MBPAmylose resin, TEV cleavage, SEC
Full transmembrane constructFull-lengthP. pastorisDetergent extraction, IMAC, SEC

Quality Control Methods:

  • Circular dichroism to verify secondary structure

  • Thermal shift assays to assess stability

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Limited proteolysis to identify stable domains

This comprehensive approach addresses the challenges inherent in purifying a complex membrane-associated protein while providing flexibility to focus on specific domains or functions of interest .

What imaging techniques are most effective for visualizing crista junctions in P. marneffei?

Visualizing crista junctions in P. marneffei requires advanced imaging techniques that provide sufficient resolution to observe these nanoscale mitochondrial structures. Based on successful approaches in model organisms and the specific challenges of P. marneffei:

Electron Microscopy Techniques:

  • Transmission Electron Microscopy (TEM) with Specific Sample Preparation:

    • Diaminobenzidine (DAB) staining enhances mitochondrial membrane visualization

    • High-pressure freezing followed by freeze substitution preserves native membrane architecture

    • Serial sectioning to capture the three-dimensional organization of cristae

  • Electron Tomography:

    • Provides 3D reconstructions at nanometer resolution

    • Allows precise measurement of crista junction diameter and distribution

    • Dual-axis tomography improves resolution of membrane continuities

  • Cryo-Electron Microscopy:

    • Preserves native structure without chemical fixation artifacts

    • Particularly valuable for comparing yeast and hyphal forms at different temperatures

Super-Resolution Fluorescence Microscopy:

  • STED (Stimulated Emission Depletion) Microscopy:

    • Combined with specific labels for MICOS components

    • Can achieve ~30-50 nm resolution to visualize larger crista junction structures

  • Structured Illumination Microscopy (SIM):

    • Lower resolution than STED but allows multi-color imaging

    • Useful for colocalizing Fcj1 with other mitochondrial proteins

Combined and Correlative Approaches:

  • Correlative Light and Electron Microscopy (CLEM):

    • Tag Fcj1 with both fluorescent proteins and electron-dense markers

    • Allows identification of specific cells/mitochondria by fluorescence followed by ultrastructural analysis

  • Expansion Microscopy:

    • Physical expansion of samples allows visualization of crista junctions with conventional confocal microscopy

    • Particularly useful for thick mycelial samples

Experimental Protocol Recommendations:

For optimal visualization of crista junctions in P. marneffei:

  • Compare both yeast (37°C) and filamentous (25°C) forms

  • Use wild-type, Fcj1-tagged, and Fcj1 mutant strains

  • Quantify crista junction diameter, density, and distribution

  • Correlate ultrastructural observations with functional assays

These approaches provide complementary information about the dynamic organization of crista junctions and how they may be remodeled during P. marneffei's dimorphic transitions .

How can researchers generate and validate Fcj1 knockout or conditional mutations in P. marneffei?

Creating and validating Fcj1 genetic modifications in P. marneffei requires specialized approaches that account for this organism's unique biology. Here is a comprehensive methodology:

Gene Targeting Strategies:

  • CRISPR-Cas9 System:

    • Design sgRNAs targeting the FCJ1 gene with P. marneffei-optimized codon usage

    • Include a selectable marker (hygromycin or G418 resistance) flanked by homology arms

    • Deliver components via polyethylene glycol (PEG)-mediated protoplast transformation

  • Homologous Recombination Approach:

    • Generate targeting constructs with 1-1.5 kb homology arms flanking the FCJ1 locus

    • Include positive (drug resistance) and negative (thymidine kinase) selection markers

    • Target different domains selectively for domain-specific functional analysis

  • Conditional Systems:

    • Tetracycline-inducible promoter system for controllable expression

    • Temperature-sensitive degron tags that allow protein degradation at specific temperatures

    • Auxin-inducible degron system for rapid protein depletion

Validation Methods:

  • Genomic Verification:

    • PCR screening with primers spanning expected integration sites

    • Southern blot analysis to confirm correct integration and exclude multiple insertions

    • Whole-genome sequencing to identify potential off-target effects

  • Transcript and Protein Analysis:

    • RT-qPCR to quantify FCJ1 mRNA levels

    • Western blotting with anti-Fcj1 antibodies to confirm protein absence/reduction

    • Immunofluorescence microscopy to verify localization patterns in conditional mutants

  • Functional Validation:

    • Electron microscopy to assess mitochondrial ultrastructure

    • Growth phenotype analysis at different temperatures (25°C vs. 37°C)

    • Respiration measurements using oxygen consumption assays

    • Mitochondrial membrane potential assessment using potentiometric dyes

Expected Phenotypes for Validation:

Based on studies in other organisms, true Fcj1-deficient mutants should display:

  • Abnormal cristae morphology with stacked lamellar structures

  • Reduced number of crista junctions

  • Growth defects on non-fermentable carbon sources

  • Altered mitochondrial network morphology

Complementation Studies:

To confirm phenotype specificity:

  • Reintroduce wild-type FCJ1 at an ectopic locus under a constitutive or native promoter

  • Create domain-specific complementation constructs

  • Test interspecies complementation with S. cerevisiae or mammalian mitofilin

This comprehensive approach allows for rigorous validation of the genetic modifications and provides a foundation for further functional studies of Fcj1 in P. marneffei's unique dimorphic lifecycle .

What protein-protein interaction methods are most suitable for identifying P. marneffei Fcj1 binding partners?

Identifying Fcj1 interaction partners in P. marneffei requires specialized approaches for membrane-associated proteins, particularly considering the dimorphic nature of this pathogen. The following methods offer complementary strengths:

Affinity-Based Methods:

  • Tandem Affinity Purification (TAP):

    • Generate P. marneffei strains expressing Fcj1 with a TAP tag (Protein A-TEV-CBP)

    • Optimize gentle solubilization conditions for membrane proteins (digitonin/DDM)

    • Compare interactomes between mold (25°C) and yeast (37°C) forms

    • Analyze purified complexes using mass spectrometry

  • BioID or TurboID Proximity Labeling:

    • Fuse biotin ligase to Fcj1 to biotinylate proteins in close proximity

    • Particularly valuable for capturing transient or weak interactions

    • Can identify spatial relationships in the native mitochondrial environment

    • Streptavidin pulldown followed by mass spectrometry identification

  • Co-immunoprecipitation with Domain-Specific Antibodies:

    • Generate antibodies against specific Fcj1 domains

    • Perform IP under varying detergent and salt conditions

    • Use crosslinking to stabilize transient interactions

Biochemical and Biophysical Methods:

  • Blue Native PAGE:

    • Preserves native protein complexes

    • Can reveal Fcj1 incorporation into MICOS and other complexes

    • Compare complex formation at different temperatures

    • Excise bands for mass spectrometry identification

  • Chemical Crosslinking Coupled with Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers of different lengths

    • Provides spatial constraints for interaction modeling

    • Can capture dynamic interactions during morphological transitions

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Identifies interaction interfaces through differential solvent accessibility

    • Particularly useful for examining conformational changes upon binding

Genetic and In Vivo Methods:

  • Split-Fluorescent Protein Complementation:

    • Fuse candidate interactors with complementary fragments of a fluorescent protein

    • Visualize interactions in living cells

    • Can reveal subcellular localization of interactions

  • Yeast Two-Hybrid Adaptations:

    • Use split-ubiquitin membrane yeast two-hybrid for membrane proteins

    • Test specific domains of Fcj1 against cDNA libraries

    • Validate interactions with other techniques

Integrated Data Analysis:

Combine multiple approaches in a workflow:

  • Initial screening using TAP-MS or BioID

  • Confirmation of top candidates with co-IP

  • Detailed characterization of key interactions using XL-MS

  • Functional validation through genetic interaction studies

  • Structural model development using interaction constraints

This comprehensive approach would reveal the P. marneffei Fcj1 interactome and how it may differ between morphological states, potentially uncovering unique adaptations relevant to pathogenicity .

What are the major technical challenges in studying the relationship between mitochondrial dynamics and P. marneffei pathogenicity?

Investigating the connection between mitochondrial dynamics and P. marneffei pathogenicity presents several significant technical challenges that researchers must overcome:

Organism-Specific Challenges:

  • Dimorphic Nature:

    • Maintaining consistent morphological states during experiments

    • Capturing transition phases between yeast and mold forms

    • Developing protocols that work effectively in both morphological states

  • Biosafety Considerations:

    • P. marneffei is a BSL-2 pathogen, limiting some experimental approaches

    • Need for specialized containment when working with infectious forms

    • Challenges in direct host-pathogen interaction studies

Mitochondrial Visualization Challenges:

  • Dynamic Organelles in Living Cells:

    • Mitochondria undergo constant fusion/fission and remodeling

    • Need for high-speed imaging to capture dynamic processes

    • Photobleaching and phototoxicity during long-term imaging

  • Resolution Limitations:

    • Crista junctions are approximately 15-40 nm in diameter, beyond conventional light microscopy resolution

    • Need for specialized super-resolution or electron microscopy approaches

    • Sample preparation artifacts affecting native mitochondrial architecture

Experimental Model Challenges:

  • Lack of Standardized Infection Models:

    • Limited availability of relevant cell culture and animal models

    • Challenges in maintaining P. marneffei in its pathogenic form during infections

    • Difficulty correlating in vitro findings with in vivo pathogenesis

  • Genetic Manipulation Difficulties:

    • Lower transformation efficiency compared to model fungi

    • Limited availability of well-characterized promoters and genetic tools

    • Challenges in creating conditional mutants of essential genes like FCJ1

Methodological Solutions:

  • Advanced Imaging Approaches:

    • Correlative light and electron microscopy (CLEM) to link dynamics to ultrastructure

    • Live-cell super-resolution microscopy with minimal phototoxicity

    • Expansion microscopy to physically enlarge samples for better resolution

  • Genetic System Development:

    • Optimization of CRISPR-Cas9 systems specifically for P. marneffei

    • Development of tight inducible expression systems

    • Creation of fluorescent reporter strains for mitochondrial dynamics

  • Infection Model Refinement:

    • Development of macrophage infection systems with live imaging capabilities

    • Zebrafish infection models for transparent in vivo observation

    • Co-culture systems mimicking environmental-to-host transitions

By addressing these technical challenges, researchers can begin to unravel the complex relationship between Fcj1-mediated mitochondrial architecture and the pathogenicity mechanisms of this important fungal pathogen .

How might understanding P. marneffei Fcj1 contribute to developing novel antifungal strategies?

Understanding P. marneffei Fcj1 could open innovative pathways for antifungal development through several mechanistic approaches, providing alternatives to current treatment options for penicilliosis marneffei.

Potential Therapeutic Strategies Targeting Fcj1:

  • Disruption of Critical Protein-Protein Interactions:

    • Target specific interfaces between Fcj1 and TOB/SAM complex components

    • Develop small molecules that prevent Fcj1 oligomerization

    • Design peptidomimetics that interfere with MICOS complex assembly

  • Exploitation of Conformational Changes:

    • Target temperature-dependent structural transitions in Fcj1

    • Develop compounds that lock the protein in non-functional conformations

    • Create allosteric modulators that prevent adaptation to host temperature

  • Selective Targeting of Unique Domains:

    • Identify P. marneffei-specific structural features in Fcj1 absent in human mitofilin

    • Design inhibitors that exploit fungal-specific binding pockets

    • Develop aptamers with high specificity for fungal Fcj1

Advantages of Fcj1 as a Drug Target:

  • Essential Function: Fcj1 is critical for proper mitochondrial function, making it an essential target that would be difficult for the pathogen to compensate for

  • Surface Accessibility: As a membrane protein with domains extending into the intermembrane space, Fcj1 may be more accessible to drugs than intracellular targets

  • Unique to Fungi: While humans have a homolog (mitofilin), there are sufficient structural differences to potentially allow selective targeting

Experimental Approaches for Drug Discovery:

  • Structure-Based Design:

    • Determine high-resolution structures of P. marneffei Fcj1 domains

    • Perform in silico screening for compounds that bind to critical interfaces

    • Iterate through medicinal chemistry optimization of lead compounds

  • Phenotypic Screening:

    • Develop assays measuring mitochondrial function in P. marneffei

    • Screen compound libraries for those that disrupt cristae morphology

    • Identify molecules that specifically affect the yeast form at 37°C

  • Combination Therapy Exploration:

    • Test Fcj1-targeting compounds with existing antifungals like amphotericin B and itraconazole

    • Identify synergistic combinations that reduce required dosages

    • Develop dual-targeting approaches to reduce resistance development

By focusing on the unique aspects of P. marneffei Fcj1 while leveraging its essential nature, researchers could develop antifungals with novel mechanisms of action, potentially overcoming existing resistance mechanisms and providing new options for treating this important opportunistic infection .

What are the emerging technologies that could advance our understanding of P. marneffei mitochondrial biology?

Several cutting-edge technologies are poised to revolutionize our understanding of P. marneffei mitochondrial biology and Fcj1 function. These emerging approaches could overcome existing technical barriers and provide unprecedented insights:

Advanced Imaging Technologies:

  • Cryo-Electron Tomography:

    • Visualize native macromolecular complexes in their cellular context

    • Capture mitochondrial architecture during morphological transitions

    • Achieve molecular resolution (~4Å) of protein complexes in situ

    • Potential to visualize the MICOS complex in different fungal morphotypes

  • 4D Live Cell Super-Resolution Microscopy:

    • Track mitochondrial dynamics during host-pathogen interactions

    • Lattice light-sheet microscopy with adaptive optics for reduced phototoxicity

    • Visualize cristae remodeling during temperature shifts in real-time

    • Correlate dynamics with pathogenic processes

  • Expansion Microscopy Advances:

    • Physical expansion of samples to overcome resolution limits

    • Combined with clearing techniques for deeper imaging in mycelial networks

    • Multi-round labeling for comprehensive protein localization maps

Molecular and Genetic Technologies:

  • Genome and Protein Engineering:

    • Prime editing for precise genome modifications without double-strand breaks

    • Optogenetic control of Fcj1 function and mitochondrial dynamics

    • Base editors for introducing specific mutations in FCJ1

  • Single-Cell Technologies:

    • Single-cell RNA-seq to capture transcriptional heterogeneity

    • Spatial transcriptomics to map gene expression patterns in colonies

    • Single-cell proteomics to analyze protein-level responses

  • Protein Structure Determination:

    • AlphaFold2 and RoseTTAFold predictions of P. marneffei protein structures

    • Integrative structural biology combining cryo-EM, crosslinking-MS, and modeling

    • High-throughput crystallization of membrane proteins in lipidic cubic phase

Systems Biology Approaches:

  • Multi-omics Integration:

    • Combined proteomics, metabolomics, and lipidomics of mitochondria

    • Network modeling of mitochondrial adaptations during morphological transitions

    • Flux analysis to quantify metabolic rewiring at different temperatures

  • Advanced Bioinformatics:

    • Evolutionary analysis of mitochondrial architecture proteins across fungal species

    • Machine learning to identify patterns in mitochondrial responses to stresses

    • Molecular dynamics simulations of Fcj1 in membrane environments

Microfluidic and Organ-on-a-Chip Technologies:

  • Controlled Microenvironments:

    • Precise temperature gradients to study morphological transitions

    • Co-culture systems with immune cells to model host interactions

    • Continuous monitoring of mitochondrial functions during infection models

These emerging technologies, particularly when used in complementary combinations, promise to transform our understanding of P. marneffei mitochondrial biology, potentially revealing novel therapeutic targets and fundamental insights into this important dimorphic pathogen .

What are the most promising research directions for understanding P. marneffei Fcj1 in the context of fungal pathogenesis?

Research on P. marneffei Fcj1 stands at a critical intersection of mitochondrial biology and fungal pathogenesis. Several high-priority research directions could yield significant insights:

Integrating Mitochondrial Dynamics with Virulence Mechanisms:

  • Temperature-Responsive Mitochondrial Remodeling:

    • Investigate how Fcj1-dependent mitochondrial architecture changes during the critical 25°C to 37°C transition

    • Determine if these changes are required for successful host adaptation

    • Identify regulatory factors that control Fcj1 function during temperature shifts

  • Host-Pathogen Interface Studies:

    • Examine mitochondrial remodeling during macrophage infection

    • Analyze whether host immune responses target mitochondrial functions

    • Investigate if Fcj1-dependent processes influence immune recognition

  • Metabolic Adaptation Mechanisms:

    • Map how changes in cristae architecture correlate with metabolic reprogramming

    • Determine if Fcj1 function influences antifungal drug susceptibility

    • Investigate connections between mitochondrial architecture and iron metabolism

Comparative Approaches:

  • Cross-Species Comparisons:

    • Compare Fcj1 structure and function between pathogenic and non-pathogenic Penicillium species

    • Analyze evolutionary adaptations in Fcj1 across thermally dimorphic fungi

    • Identify conserved and divergent features that may relate to pathogenicity

  • Clinical Isolate Studies:

    • Analyze mitochondrial phenotypes in clinical isolates with varying virulence

    • Investigate potential Fcj1 polymorphisms associated with disease severity

    • Examine drug-resistant isolates for compensatory mitochondrial adaptations

Technological Innovation Directions:

  • Development of P. marneffei-Specific Tools:

    • Create conditional Fcj1 mutants with temperature-sensitive regulation

    • Develop live-cell imaging systems compatible with host-pathogen models

    • Establish CRISPR-based screens for genes that synthetically interact with FCJ1

  • Therapeutic Target Exploration:

    • Screen for compounds that specifically disrupt Fcj1 function at 37°C

    • Investigate combination approaches targeting mitochondrial function

    • Explore immunomodulatory strategies that target fungal mitochondria

By pursuing these research directions, investigators could establish mechanistic links between mitochondrial architecture and P. marneffei pathogenicity, potentially revealing novel therapeutic approaches for this important opportunistic infection while advancing our fundamental understanding of mitochondrial biology in pathogenic fungi .

How might comparative studies between different fungal species enhance our knowledge of Fcj1 evolution and specialization?

Comparative studies across fungal species offer powerful insights into Fcj1 evolution and functional specialization that could reveal fundamental principles about mitochondrial architecture and adaptation mechanisms.

Evolutionary Analysis Approaches:

  • Phylogenetic Analysis of Fcj1 Sequences:

    • Compare Fcj1 proteins across fungal lineages, from saprophytes to pathogens

    • Map domain conservation and divergence across thermally dimorphic fungi

    • Identify signatures of positive selection that might indicate adaptive evolution

  • Structure-Function Relationship Mapping:

    • Compare the C-terminal domains across species to identify conserved interaction interfaces

    • Analyze coiled-coil domains for species-specific variations that might affect oligomerization

    • Compare transmembrane domains for adaptations to different membrane compositions

  • MICOS Complex Evolution:

    • Compare MICOS composition across fungal lineages

    • Identify lineage-specific subunits or adaptations

    • Analyze co-evolution patterns between Fcj1 and other MICOS components

Comparative Functional Studies:

  • Cross-Species Complementation Experiments:

    • Test whether P. marneffei Fcj1 can rescue defects in S. cerevisiae fcj1Δ strains

    • Swap specific domains between species to identify functionally divergent regions

    • Create chimeric proteins to map temperature-sensitive adaptations

  • Comparative Ultrastructural Analysis:

    • Compare cristae architecture across species with different ecological niches

    • Assess whether pathogenic species show specific adaptations in mitochondrial structure

    • Examine temperature-dependent changes across dimorphic and non-dimorphic fungi

Methodology for Comprehensive Comparison:

Comparative AspectAnalytical ApproachExpected Insights
Sequence evolutionPhylogenetic analysis, selection analysisIdentification of conserved/divergent regions, selection pressures
Structural conservationHomology modeling, AlphaFold2 predictionsSpecies-specific structural adaptations, binding interface evolution
Functional conservationHeterologous expression, domain swappingIdentification of functionally critical regions, species-specific functions
Interaction networksComparative interactomics, network evolutionEvolution of protein-protein interactions, pathogen-specific adaptations
Expression patternsComparative transcriptomics under stress conditionsRegulatory evolution, stress-response adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.