Recombinant Penicillium marneffei Probable endonuclease lcl3 (lcl3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize development with the specified tag.
Synonyms
lcl3; PMAA_053390; Probable endonuclease lcl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei)
Target Names
lcl3
Target Protein Sequence
MGWWSLGSSGSKADPEKSKANDSKSSNRRQQEEGEQSFIPPPLTSRTSSSSSSKSTTDWN SSLNAFDWSQFKQPRNLIPTALLTGGILFVVYVQRRYLRRFPEATDISSSYFRSRSLLGR VTSVGDGDNFRIFHTPGGRLVGWGWLPWMKVPTARKELKDKTVHIRLAGVDAPELAHFGR PAQPYAYEAHMWLTSYLMNRRVRAYVHRPDQYKRVIATVYVRRWLDFPPLRRRDVSYEML RRGLATVYEAKSGVEFGGTENERKYREAEMLAKNRRQGLWKDFGKRGGVNFESPREYKTR MQSLDMSAESSSSSSSSSNTEKNPGLVGSLLRKVWPFGSKKDGT
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Penicillium marneffei and why is it clinically significant?

Penicillium marneffei is a dimorphic fungal pathogen that causes penicilliosis, an invasive fungal infection primarily affecting immunocompromised individuals, particularly those with HIV/AIDS. It is endemic to Southeast Asia, India, and China, where it is regarded as an AIDS-defining illness with mortality rates ranging from 10-30% even with treatment . The severity of P. marneffei infection directly correlates with the patient's immunological status, with CD4+ T-cell counts below 50 cells/μL observed in 93.6% of infected individuals . The disease presents with fever, weight loss, skin lesions, respiratory symptoms, and often involves multiple organ systems.

The clinical importance of P. marneffei has grown significantly with the HIV epidemic in endemic regions. Studies show that penicilliosis accounts for approximately 4.8% of AIDS-related hospital admissions in affected areas . Transmission likely occurs through environmental exposure, with soil contact during rainy seasons considered a critical risk factor .

What is the probable endonuclease lcl3 in P. marneffei and what is its known function?

The probable endonuclease lcl3 is a protein encoded by the lcl3 gene (PMAA_053390) in Penicillium marneffei . While its specific function in P. marneffei remains under investigation, it belongs to the endonuclease family of enzymes that generally catalyze the cleavage of phosphodiester bonds within nucleic acid chains. By comparison with better-characterized endonucleases, lcl3 likely plays roles in DNA repair, recombination, or restriction-modification systems within the fungal genome.

Endonucleases typically recognize and bind to specific DNA sequences, making double-strand breaks that can be important for genome maintenance and evolution . The lcl3 protein may function similarly to homing endonucleases found in other organisms, which recognize long DNA target sites (14-40 bp) and show tolerance to minor sequence changes within these sites . Further functional characterization studies are needed to confirm the exact biological role of lcl3 in P. marneffei.

How is P. marneffei typically identified in clinical or research settings?

P. marneffei identification employs several complementary techniques:

MethodSensitivitySpecificityTime RequiredNotes
Fungal Culture62.5-88.9% (varies by sample type)>99%3-7 daysGold standard but slow
Galactomannan (GM) Test95.8%90.9%3-4 hoursRapid method, cross-reactivity with Aspergillus
Microscopic Examination70-80%85-90%1-2 hoursRapid but requires expertise
Molecular Techniques (PCR)>95%>95%4-6 hoursNot widely standardized

Notably, serum galactomannan testing using the Platelia Aspergillus Enzyme Immunoassay Kit has emerged as a promising rapid diagnostic tool. Studies demonstrate a sensitivity of 95.8% and specificity of 90.9% when using a cutoff index of 1.0, indicating significant cross-reactivity between P. marneffei and Aspergillus antigens . This cross-reactivity provides a valuable diagnostic opportunity in resource-limited settings.

What is known about the gene encoding the lcl3 endonuclease in P. marneffei?

The lcl3 gene (designated as PMAA_053390 in genomic databases) encodes the probable endonuclease lcl3 in Penicillium marneffei strain ATCC 18224/CBS 334.59/QM 7333 . The gene produces a full-length protein of 344 amino acids. While detailed characterization of the lcl3 gene promoter and regulatory elements is limited in current literature, the gene likely shares regulatory mechanisms with other fungal genes involved in genome maintenance.

By comparison with genes encoding similar endonucleases in other fungi, the lcl3 gene may be regulated in response to DNA damage, oxidative stress, or specific developmental stages of the fungus. Research on P. marneffei has identified several genes involved in asexual development and fungal morphogenesis , and lcl3 may play a role in these processes, particularly during the dimorphic transition between hyphal and yeast forms that is crucial for pathogenesis.

What methodologies are effective for expressing and purifying recombinant P. marneffei lcl3 protein?

The expression and purification of recombinant P. marneffei lcl3 endonuclease requires careful consideration of several factors to maintain protein stability and enzymatic activity. Based on successful approaches with other fungal endonucleases, the following methodology is recommended:

Expression System Selection:

  • Prokaryotic: E. coli BL21(DE3) for high yield but potential inclusion body formation

  • Eukaryotic: Pichia pastoris or Saccharomyces cerevisiae for proper folding and post-translational modifications

  • Insect cell/baculovirus system for complex eukaryotic proteins with specific folding requirements

Optimization Protocol:

  • Clone the lcl3 gene into an expression vector with an appropriate promoter (T7 for E. coli; AOX1 for P. pastoris)

  • Include a purification tag (His6, GST, or MBP) that can later be removed using a specific protease

  • Express at lower temperatures (16-18°C) to enhance proper folding

  • Include metal ion cofactors (Mg2+ or Mn2+) in buffers to stabilize the active site

  • Test multiple buffer conditions (pH 6.5-8.0) to identify optimal stability parameters

Purification Strategy:

  • Initial capture using affinity chromatography based on the fusion tag

  • Intermediate purification using ion-exchange chromatography

  • Final polishing with size-exclusion chromatography

  • Storage in a stabilizing buffer containing glycerol (25-50%) and reducing agents

For functional assays, the purified lcl3 protein should be tested with various divalent cations, as endonucleases typically require these for catalytic activity . Additionally, protein concentration should be carefully optimized, as excessive concentrations may lead to non-specific nuclease activity.

How does the lcl3 endonuclease compare structurally and functionally to other known fungal endonucleases?

While specific structural data for lcl3 is limited, comparative analysis with characterized fungal endonucleases provides valuable insights into its potential structure-function relationships. Based on sequence characteristics, lcl3 may share features with the LAGLIDADG family of homing endonucleases found in various fungi.

EndonucleaseOrganismActive Site FeaturesDNA RecognitionCatalytic Mechanism
I-CreIChlamydomonas reinhardtiiLAGLIDADG motifHomodimer recognizing palindromic sitesRequires divalent cations (Mg2+)
I-DmoIDesulfurococcus mobilisTwo LAGLIDADG motifsMonomeric recognition of asymmetric sitesMetal ion coordination
PI-SceISaccharomyces cerevisiaeTwo LAGLIDADG motifsRecognition of long target sequencesTwo-metal ion catalysis
lcl3 (predicted)Penicillium marneffeiPotential metal-binding residuesUnknown specificityLikely phosphodiesterase activity

Unlike well-characterized homing endonucleases that typically reside within group I introns or inteins, the genomic context of lcl3 suggests it may function as a standalone endonuclease . The absence of apparent intron or intein association might indicate divergent functions compared to canonical homing endonucleases.

Functionally, while homing endonucleases such as I-CreI and I-DmoI typically catalyze highly specific double-strand breaks for mobile genetic element propagation, lcl3 may have evolved broader specificity for processes such as DNA recombination, repair, or restriction. Some fungal LAGLIDADG proteins have dual roles as endonucleases and maturases (aiding RNA splicing), and further research should investigate whether lcl3 possesses similar multifunctional capabilities .

What role might the lcl3 endonuclease play in P. marneffei pathogenesis?

The potential role of lcl3 endonuclease in P. marneffei pathogenesis represents an intriguing area for investigation. While direct evidence linking lcl3 to virulence is currently limited, several hypothetical mechanisms warrant exploration:

  • Genomic Adaptation: Endonucleases can facilitate genomic rearrangements, potentially enabling adaptation to host environments. P. marneffei undergoes a temperature-dependent dimorphic transition critical for pathogenesis, and lcl3 may contribute to genomic plasticity supporting this adaptation.

  • Stress Response Regulation: Fungal pathogens must overcome various host defense mechanisms, including oxidative stress. If lcl3 participates in DNA repair pathways, it might enhance P. marneffei survival within macrophages, where it can persist as an intracellular pathogen.

  • Modulation of Host Interactions: Some fungal proteins directly interact with host components. If lcl3 is secreted or exposed during infection, it could potentially interfere with host nucleic acid processing or signaling pathways.

The timing of lcl3 expression during infection cycles would provide valuable insights into its role. P. marneffei infection typically causes severe manifestations in immunocompromised individuals with CD4+ T-cell counts below 50 cells/μL , suggesting complex interactions with host immunity where lcl3 might play a direct or indirect role.

Research approaches to investigate lcl3's role in pathogenesis should include:

  • Gene knockout studies to assess virulence in animal models

  • Transcriptional profiling during infection stages

  • Localization studies to determine if lcl3 remains intracellular or is secreted

  • Interactome analysis to identify potential host or pathogen protein partners

How can recombinant lcl3 be utilized in developing diagnostic tools for P. marneffei infection?

Recombinant lcl3 protein offers promising applications for enhancing P. marneffei diagnostics, potentially addressing current limitations in early detection. Several approaches for diagnostic tool development include:

Serological Assays:

  • ELISA systems utilizing recombinant lcl3 as a capture antigen to detect antibody responses in patient sera

  • Lateral flow immunoassays for point-of-care testing in resource-limited settings

  • Multiplexed protein arrays combining lcl3 with other P. marneffei antigens to improve sensitivity

Performance Optimization:

  • Pre-coating assay surfaces with specific buffers to reduce non-specific binding

  • Utilizing reporter systems (fluorescent, colorimetric, or chemiluminescent) optimized for the clinical setting

  • Incorporation of internal controls to ensure assay reliability

Early diagnosis significantly improves patient outcomes, as delayed diagnosis is an independent predictor of early mortality in penicilliosis . Current diagnostic methods like galactomannan testing show promising sensitivity (95.8%) and specificity (90.9%) , but lcl3-based assays could potentially offer improved specificity while maintaining high sensitivity.

The development pathway should include:

  • Assessment of lcl3 antigenicity and immunogenicity

  • Determination of optimal recombinant protein fragments for assay development

  • Validation using serum banks from confirmed cases and relevant control groups

  • Field testing in endemic areas with comparison to existing diagnostic standards

What experimental approaches can be used to characterize the catalytic activity of lcl3?

Characterization of lcl3's catalytic activity requires a systematic approach combining biochemical, biophysical, and computational methods:

Substrate Preference Analysis:

  • Incubate purified lcl3 with various DNA substrates (single-stranded, double-stranded, supercoiled, linear)

  • Analyze cleavage products using gel electrophoresis and sequencing to determine:

    • Cut site preferences

    • Sequence specificity

    • Rate of catalysis under varying conditions

Catalytic Parameters Determination:

  • Enzyme kinetics studies to establish Km, kcat, and catalytic efficiency

  • Metal ion dependency tests with various divalent cations (Mg2+, Mn2+, Ca2+, Zn2+)

  • pH optimization and temperature stability profiling

Site-Directed Mutagenesis:
Based on sequence alignment with well-characterized endonucleases like I-CreI, identify and mutate putative catalytic residues. Key targets would include conserved acidic residues (E, D) that typically coordinate metal ions in the active site, as seen in the LAGLIDADG family where residues like E75 are required for catalytic activity .

Structural Studies:

  • X-ray crystallography of lcl3 alone and in complex with substrate DNA

  • Hydrogen-deuterium exchange mass spectrometry to map protein-DNA interaction surfaces

  • Molecular dynamics simulations to model catalytic mechanism

The experimental design should account for potential challenges, including the possibility that lcl3 might require specific cofactors or conditions for activity. If initial assays show limited activity, consider testing under conditions that mimic the fungal cellular environment, including physiologically relevant salt concentrations, redox conditions, and potential protein partners.

What are the potential implications of lcl3 for understanding P. marneffei genomic integrity and evolution?

The study of lcl3 endonuclease provides a unique window into P. marneffei genome dynamics and evolutionary processes. As a probable endonuclease, lcl3 may participate in several genomic maintenance pathways with significant evolutionary implications:

Genome Stability Mechanisms:
Endonucleases typically function in DNA repair pathways that maintain genomic integrity against environmental stressors. P. marneffei encounters diverse environments, transitioning between saprophytic growth in soil and pathogenic yeast forms in human hosts at 37°C . This environmental adaptability requires sophisticated DNA damage response systems where lcl3 may play a crucial role.

Evolutionary Adaptations:
Fungal endonucleases often function as selfish genetic elements or regulators of mobile genetic elements. By analyzing the genomic context of lcl3 and its conservation across related species, researchers can gain insights into:

  • Horizontal gene transfer events in the evolutionary history of P. marneffei

  • Selection pressures shaping the pathogen's genome

  • Potential involvement in adaptive genomic rearrangements

Research Applications:

  • Comparative genomics across clinical and environmental P. marneffei isolates to assess lcl3 sequence conservation

  • Analysis of lcl3 expression during environmental transitions

  • Investigation of potential lcl3 involvement in DNA recombination events during meiosis or mitosis

Understanding lcl3's role in genomic integrity might also explain P. marneffei's remarkable adaptability across different ecological niches. Additionally, if lcl3 contributes to genetic diversity mechanisms, it could influence the pathogen's ability to develop antifungal resistance—a growing concern in clinical management.

How might targeting lcl3 contribute to antifungal therapy development?

The distinctive properties of fungal endonucleases make lcl3 a potentially valuable target for novel antifungal development. Several therapeutic strategies could exploit lcl3 functions:

Target Validation Approaches:

  • Gene knockdown studies to assess essentiality of lcl3 for fungal viability

  • Phenotypic characterization of lcl3-deficient strains for growth, stress response, and virulence

  • Complementation studies to confirm phenotype specificity

Drug Development Strategies:

  • Structure-based design of small molecule inhibitors targeting the lcl3 active site

  • Peptide inhibitors mimicking DNA substrate binding interfaces

  • Allosteric modulators affecting protein conformation or oligomerization

The ideal lcl3 inhibitor would demonstrate:

  • High selectivity for fungal over human nucleases

  • Favorable pharmacokinetic properties for reaching intracellular fungi

  • Synergistic activity with existing antifungals like amphotericin B

Potential Advantages:
Targeting lcl3 could provide unique benefits compared to current antifungals:

  • Novel mechanism of action to address emerging resistance

  • Potential specificity for P. marneffei, minimizing collateral damage to beneficial microbiota

  • Possible application in combination therapies to reduce required doses of toxic antifungals

Early mortality in AIDS-associated penicilliosis remains high (21.3%), with delayed diagnosis and lack of antifungal therapy as independent predictors of poor outcomes . Novel therapeutics targeting fungal-specific proteins like lcl3 could address this significant unmet clinical need, particularly in endemic regions with high HIV prevalence.

What molecular techniques are optimal for studying lcl3 expression during different phases of P. marneffei infection?

Investigating lcl3 expression throughout the P. marneffei infection cycle requires a multi-faceted approach combining classical and cutting-edge molecular techniques:

Expression Analysis Techniques:

TechniqueApplicationAdvantagesLimitations
RT-qPCRQuantitative measurement of lcl3 transcript levelsHigh sensitivity, specific quantificationLimited to transcript analysis
RNAseqTranscriptome-wide analysis including lcl3Contextual expression data, splice variant detectionComplex data analysis, cost
Proteomicslcl3 protein abundance and modificationsDirect protein measurement, PTM analysisRequires specific antibodies
Reporter ConstructsIn vivo visualization of expressionReal-time monitoring, spatial informationGenetic modification required

Experimental Models:

  • In vitro cultures: Compare lcl3 expression between:

    • Mycelial form (25°C) vs. yeast form (37°C)

    • Nutrient-rich vs. nutrient-limited conditions

    • Various pH environments mimicking host niches

  • Cell culture systems:

    • Macrophage infection models to study intracellular expression

    • Co-cultures with human alveolar epithelial cells

  • Animal models:

    • Murine models of disseminated infection

    • Tissue-specific expression analysis from infected organs

Cutting-Edge Approaches:

  • Single-cell RNA sequencing to capture expression heterogeneity within fungal populations

  • Ribosome profiling to assess translational efficiency of lcl3 mRNA

  • CRISPR interference for temporal control of lcl3 expression to determine critical infection phases

P. marneffei exhibits a temperature-dependent dimorphic transition essential for pathogenesis, and studying lcl3 expression during this transition could reveal its role in adaptation to the host environment. Special attention should be paid to expression patterns in samples from HIV-infected patients with CD4+ counts below 50 cells/μL, as this represents the highest risk group for severe penicilliosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.