Recombinant Penicillium marneffei Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
get1; PMAA_027540; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei)
Target Names
get1
Target Protein Sequence
MISFLLLIFLIQLAIYIVNTIGSSTIDDLLWILYLRLPMPISKDTRKHGELKHDVVQLKR EMNATSSQDEFAKWAKLRRRHDKAMEEYEAMNRSMGSRKTSFQFSIKIARWLTLNGPRLF IQFYYTKTPVFDLPAGWFPYPVEWILSFPRAPLGSVSIQVWSSACATAISLAGDVVIAVV QRRQASNRQAQAVPAGKSEAATK
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble Get3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does the GET pathway operate in fungal systems?

The GET pathway in fungi represents a conserved mechanism for targeting and inserting tail-anchored membrane proteins. The pathway involves:

  • Recognition stage: Sgt2 (small glutamine-rich tetratricopeptide repeat-containing protein 2) initially recognizes the transmembrane domain of TA proteins

  • Transfer stage: Get4 and Get5 transfer the TA protein to Get3, forming a Get3-TA complex

  • Targeting stage: The Get3-TA complex targets to the ER membrane where it interacts with the Get1/Get2 receptor complex

  • Insertion stage: The Get1/Get2 complex forms a channel that facilitates insertion of the TA protein into the ER membrane

In P. marneffei, this pathway follows the general fungal pattern while potentially having unique adaptations related to its dimorphic lifestyle. The pathway components in M. oryzae (Get1, Get2, Get3, Get4, and Sgt2) have been identified based on sequence, structure, and functional similarity to S. cerevisiae homologs, suggesting conservation across pathogenic fungi .

What expression systems are used for producing recombinant P. marneffei Get1?

Recombinant P. marneffei Get1 can be produced using several expression systems:

  • E. coli expression system: The most common approach involves expressing His-tagged Get1 in E. coli, allowing for purification using Ni-nitrilotriacetic acid affinity chromatography. This system enables production of the full-length (1-203aa) recombinant protein with an N-terminal His tag .

  • Pichia pastoris expression system: For studies requiring eukaryotic post-translational modifications, the P. pastoris system offers advantages. This approach has been successfully used for other P. marneffei proteins like Mp1p, where the gene is cloned into expression vectors like pPIC9K for expression in P. pastoris strain GS115 .

  • Homologous expression: For functional studies, complementation approaches in P. marneffei itself can be employed, particularly using vectors like pAN8-1 with phleomycin resistance for selection .

The choice of expression system depends on the experimental goals, with bacterial systems preferred for structural studies and eukaryotic systems for functional analyses requiring proper folding and modifications.

How can researchers experimentally distinguish the functional roles of Get1 from other similar proteins in P. marneffei?

Distinguishing Get1 function from other proteins requires multiple complementary approaches:

  • Gene knockout and complementation studies: Generate GET1 knockout mutants and complemented strains to assess phenotypic differences. This approach has been successfully used for other P. marneffei proteins like Mp1p, demonstrating specific roles in virulence . For Get1, researchers should:

    • Create GET1 knockout using homologous recombination

    • Confirm deletion by PCR and Southern blot analysis

    • Create complemented strains by reintroducing GET1

    • Assess phenotypes related to ER protein insertion and stress responses

  • Protein-protein interaction studies:

    • Use co-immunoprecipitation to identify Get1 interaction partners

    • Employ yeast two-hybrid or split-ubiquitin systems to confirm interactions with Get2, Get3, and potential TA protein substrates

    • Conduct in vitro binding assays with purified components

  • Localization studies:

    • Create GFP-tagged Get1 to visualize its subcellular localization in both yeast and mycelial forms of P. marneffei

    • Compare with markers for ER and other organelles

  • Comparative proteomics:

    • Compare the proteome profiles of GET1 knockout vs. wild-type strains to identify affected TA proteins and downstream pathways

These approaches collectively enable researchers to establish Get1-specific functions distinct from other proteins like Mp1p that may have overlapping phenotypic effects when mutated.

What biochemical approaches can be used to characterize the Get1/Get2 channel in P. marneffei?

Characterizing the Get1/Get2 channel requires specialized biochemical techniques:

  • Membrane protein reconstitution:

    • Co-express Get1 and Get2 in appropriate expression systems

    • Purify using tandem affinity tags

    • Reconstitute into liposomes or nanodiscs

  • Channel conductance measurements:

    • Use bulk fluorescence and microfluidics assays to detect channel formation, as demonstrated for other GET insertases

    • Employ patch-clamp electrophysiology to measure channel properties

    • Estimate channel diameter using size-selective fluorescent probes

  • Structural studies:

    • Apply cryo-electron microscopy to visualize the Get1/Get2 complex structure

    • Use cross-linking mass spectrometry to map interaction interfaces

    • Perform hydrogen-deuterium exchange mass spectrometry to identify conformational changes during channel opening

  • Functional reconstitution assays:

    • Develop in vitro insertion assays using purified Get1/Get2 complexes reconstituted into liposomes

    • Monitor insertion of fluorescently labeled TA proteins

    • Test the effects of mutations in Get1 transmembrane domains on channel function

These approaches provide complementary information about channel structure, conformation, and function during TA protein insertion.

How does temperature-dependent dimorphism in P. marneffei affect Get1 expression and function?

P. marneffei is a thermally dimorphic fungus, growing as filamentous mycelia at 25°C and as yeast at 37°C, with only the yeast form showing pathogenic potential . To investigate how dimorphism affects Get1:

  • Comparative transcriptomics and proteomics:

    • Compare GET1 expression levels between yeast (37°C) and mycelial (25°C) forms using qRT-PCR and western blotting

    • Conduct RNA-seq analysis to identify temperature-dependent changes in expression of GET pathway components

    • Use proteome profiling similar to methods employed for identifying differentially expressed proteins between growth phases

  • Functional assays across temperatures:

    • Assess TA protein insertion efficiency at different temperatures

    • Monitor Get1/Get2 complex formation under different thermal conditions

    • Examine localization of GFP-tagged Get1 during temperature-induced phase transitions

  • Targeted Get1 mutagenesis:

    • Identify temperature-sensitive domains through computational prediction

    • Generate temperature-sensitive GET1 mutants

    • Analyze effects on growth, morphology, and TA protein insertion

  • Interactome analysis:

    • Compare Get1 interaction partners between 25°C and 37°C using proximity labeling approaches

    • Identify temperature-dependent changes in the Get1 interactome

This multi-faceted approach would reveal whether Get1 function is differentially regulated during the dimorphic transition, potentially contributing to pathogenicity.

What is the relationship between the GET pathway and P. marneffei virulence?

The connection between the GET pathway and P. marneffei virulence can be investigated through:

  • Infection models:

    • Challenge mice with GET1 knockout, knockdown, and complemented mutants

    • Assess survival rates, fungal loads in tissues, and histopathological changes

    • Compare with established virulence factors like Mp1p

    • Evaluate GET1 mutant survival in macrophages at different time points post-infection

  • TA proteome analysis:

    • Identify TA proteins dependent on Get1/Get2 for insertion

    • Determine which TA proteins are virulence-associated

    • Create a comprehensive table of GET-dependent virulence factors

  • Host-pathogen interaction studies:

    • Investigate whether Get1 dysfunction affects P. marneffei's ability to suppress macrophage inflammation

    • Examine the impact on TUT1-mediated alternative splicing mechanisms that contribute to immune evasion

    • Assess effect on production of immunogenic surface proteins

  • Gain-of-function studies:

    • Express P. marneffei GET1 in non-pathogenic fungi

    • Determine if this enhances survival in hosts, similar to studies conducted with Mp1p in P. pastoris

While direct evidence for Get1's role in virulence is currently lacking, these approaches would establish whether Get1-dependent TA protein insertion contributes to pathogenicity.

What methodological approaches can distinguish between the roles of Get1 and Mp1p in P. marneffei?

Both Get1 and Mp1p are important P. marneffei proteins but have distinct functions that can be differentiated through:

  • Comparative sequence and structural analysis:

FeatureGet1Mp1p
Size203 amino acids 462 amino acids
FunctionTA protein insertion at ER Cell wall mannoprotein
LocalizationER membraneCell wall and secreted
GlycosylationNot reportedN and O glycosylation sites
GPI anchorNot reportedPresent
HomologsPresent in all eukaryotesUnique to P. marneffei
  • Differential knockout phenotyping:

    • Generate single and double knockouts of GET1 and MP1

    • Compare phenotypes for growth, morphology, cell wall integrity, and virulence

    • Assess whether the phenotypes are additive, synergistic, or independent

  • Protein-specific antibody studies:

    • Generate antibodies specific to Get1 and Mp1p

    • Use immunogold electron microscopy to visualize distinct localizations

    • Develop EIAs for detection in infected tissues

  • Transcriptional regulation analysis:

    • Identify transcription factors regulating GET1 versus MP1

    • Determine if their expression is co-regulated or independently controlled

    • Map the regulatory networks controlling each protein

These approaches would definitively establish the distinct functions of Get1 and Mp1p in P. marneffei biology and pathogenesis.

How can recombinant P. marneffei Get1 be used for studying the GET pathway structure-function relationship?

Recombinant Get1 enables detailed structure-function analyses through:

  • Site-directed mutagenesis approaches:

    • Target conserved residues in transmembrane domains

    • Modify predicted Get3 interaction sites

    • Create chimeric proteins with Get1 from other fungi

  • In vitro reconstitution systems:

    • Reconstitute purified Get1 with Get2 in liposomes

    • Test TA protein insertion using fluorescently labeled substrates

    • Examine effects of mutations on channel formation and conductance

  • Biophysical characterization:

    • Use circular dichroism to assess secondary structure

    • Apply nuclear magnetic resonance for structural determination

    • Employ single-molecule FRET to monitor conformational changes during TA insertion

  • Cross-species complementation:

    • Express P. marneffei Get1 in S. cerevisiae get1Δ mutants

    • Assess functional conservation and species-specific adaptations

    • Identify regions responsible for potential functional differences

These approaches would reveal how the unique features of P. marneffei Get1 contribute to GET pathway function in this pathogenic fungus.

What optimized protocols exist for producing high-quality recombinant P. marneffei Get1 for structural studies?

Producing high-quality recombinant Get1 for structural studies requires:

  • Expression optimization:

    • Test multiple expression vectors with different fusion tags (His, GST, MBP)

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Consider codon optimization for the expression host

  • Membrane protein extraction:

    • Screen detergents for optimal solubilization (DDM, LMNG, GDN)

    • Test extraction buffers with varying salt concentrations

    • Implement gentle solubilization protocols to maintain native structure

  • Purification strategy:

    • Employ two-step purification (affinity followed by size exclusion)

    • Include stabilizing agents (glycerol, specific lipids)

    • Monitor protein homogeneity by dynamic light scattering

  • Quality assessment:

    • Verify proper folding using circular dichroism

    • Assess oligomeric state by analytical ultracentrifugation

    • Confirm functionality through binding assays with Get3

For crystallography or cryo-EM studies, further stabilization using antibody fragments or nanobodies may improve structural determination outcomes.

How can researchers develop specific detection methods for P. marneffei Get1?

Developing specific detection methods for Get1 requires:

  • Antibody development:

    • Generate recombinant Get1 fragments as antigens

    • Produce polyclonal antibodies in rabbits or monoclonal antibodies

    • Validate specificity against recombinant protein and native Get1

  • PCR-based detection:

    • Design primers specific to GET1 based on unique sequences

    • Develop conventional and quantitative PCR protocols

    • Validate specificity against other fungal species

  • Mass spectrometry approaches:

    • Identify unique peptide signatures for Get1

    • Develop targeted mass spectrometry methods (MRM/PRM)

    • Create a database of Get1-specific peptides for identification

  • In situ detection:

    • Develop fluorescence in situ hybridization (FISH) for GET1 mRNA

    • Create immunofluorescence protocols using validated antibodies

    • Optimize fixation methods for preserved Get1 epitopes

These methods would enable specific detection of Get1 in research samples and potentially in diagnostic settings.

What emerging technologies could advance our understanding of Get1 function in P. marneffei?

Several cutting-edge technologies show promise for Get1 research:

  • CRISPR-Cas9 genome editing:

    • Develop optimized CRISPR protocols for P. marneffei

    • Create precise mutations in GET1 to study domain functions

    • Generate conditional GET1 knockouts for essential function studies

  • Single-cell technologies:

    • Apply single-cell RNA-seq to study GET1 expression heterogeneity

    • Use cell-specific proteomics to examine Get1 abundance in different P. marneffei cell types

    • Implement spatial transcriptomics during host infection

  • Cryo-electron tomography:

    • Visualize the native Get1/Get2 complex in cellular membranes

    • Capture the TA protein insertion process in action

    • Map the 3D organization of the GET pathway machinery

  • Integrative structural biology:

    • Combine cryo-EM, crosslinking-MS, and molecular dynamics simulations

    • Create comprehensive structural models of the Get1/Get2/Get3/TA protein complex

    • Simulate the insertion process at atomic resolution

These advanced technologies would provide unprecedented insights into Get1 function in this important pathogenic fungus.

How might comparative studies across fungal species inform our understanding of P. marneffei Get1?

Comparative studies across fungi would:

  • Identify conserved functional domains:

    • Align Get1 sequences from multiple pathogenic and non-pathogenic fungi

    • Identify conserved motifs crucial for function

    • Pinpoint P. marneffei-specific variations that might relate to its unique biology

  • Reveal evolutionary adaptations:

    • Conduct phylogenetic analysis of Get1 across the fungal kingdom

    • Correlate Get1 sequence features with ecological niches and pathogenicity

    • Identify selection pressures acting on different Get1 domains

  • Guide functional predictions:

    • Transfer functional annotations from well-studied fungi to P. marneffei

    • Predict temperature-sensitive regions based on comparison with other dimorphic fungi

    • Identify potential drug-targeting sites conserved across pathogenic species

  • Establish model systems:

    • Determine which model fungi best represent P. marneffei Get1 function

    • Develop heterologous systems for easier experimental manipulation

    • Create chimeric proteins to test domain-specific functions

Such comparative approaches would place P. marneffei Get1 within its broader evolutionary context and guide more focused functional studies.

What is the relationship between the GET pathway and therapeutic approaches for talaromycosis?

The GET pathway represents a potential therapeutic target through:

  • Pathway vulnerability assessment:

    • Determine if GET pathway inhibition selectively affects fungal viability

    • Identify if Get1 has structural differences from human homologs

    • Test whether Get1 disruption sensitizes P. marneffei to existing antifungals

  • Chemical screening approaches:

    • Develop high-throughput screens for Get1/Get2 channel inhibitors

    • Test natural product libraries for GET pathway modulators

    • Screen for compounds that disrupt Get1-Get3 interaction

  • Structural-based drug design:

    • Use Get1 structural information for in silico drug screening

    • Design peptidomimetics targeting the Get1-Get3 interface

    • Develop conformation-specific inhibitors of the Get1/Get2 channel

  • Combination therapy strategies:

    • Test GET pathway inhibitors in combination with standard antifungals

    • Evaluate synergistic effects with compounds targeting related pathways

    • Develop dual-action compounds affecting both Get1 and other targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.