Recombinant Peptide transport system permease protein sapB (sapB)

Shipped with Ice Packs
In Stock

Description

Recombinant SapB Variants and Production

Recombinant SapB is produced in heterologous expression systems for structural and functional studies. Commercial and research variants include:

Host SystemGene SourcePurityApplicationsSupplier/Study
Escherichia coliE. coli (sapB, ECK1288)≥85%AMP resistance assays, binding studiesMyBioSource
Cell-Free ExpressionSalmonella (STY1368)≥85%Structural analysis, transporter reconstitution
Haemophilus influenzaePartial sapB gene≥85%Pathogen-specific virulence studies

Mechanism of Antimicrobial Peptide Resistance

  • SapB/SapC permease transports AMPs from the periplasm to the cytoplasm, where cytoplasmic peptidases degrade them, preventing membrane damage .

  • In Haemophilus influenzae, SapB deletion caused AMPs to accumulate in the periplasm, increasing bacterial susceptibility by 2–4 fold .

Virulence Contributions

  • Klebsiella pneumoniae: SapB-mediated AMP resistance enhances intestinal epithelial translocation and liver abscess formation in mice .

  • Haemophilus ducreyi: SapB/SapC permease activity is essential for human pustule formation, with ΔsapBC mutants showing complete attenuation in virulence .

Therapeutic Implications

Targeting SapB/SapC could disrupt bacterial AMP resistance mechanisms. Notably:

  • Drug Design: Inhibitors blocking the permease channel may restore AMP efficacy against multidrug-resistant pathogens .

  • Vaccine Development: SapB is under investigation as a virulence factor antigen in K. pneumoniae and H. influenzae .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
sapB; STY1368; t1598; Peptide transport system permease protein SapB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Salmonella typhi
Target Names
sapB
Target Protein Sequence
MIIFTLRRLLLLLVTLFFLTFIGFSLSYFTPHAPLQGASLWNAWVFWFNGLLHWDFGVSS INGQLISEQLKEVFPATMELCILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALLGFS IPVFWLALLLTLFFSLTLGWLPVSGRFDLLYEVKPVTGFAIIDAWISDSPWRDEMVMSAI RHMVLPVLTLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPP VIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLIHAIRQQDYAAISAGVMVIGSLVIVVNV ISDILGAMANPLKHKEWYALR
Uniprot No.

Target Background

Function
This protein is involved in a peptide uptake transport system that contributes to antimicrobial peptide resistance.
Database Links

KEGG: stt:t1598

STRING: 220341.STY1368

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the SapB permease protein and what is its role in the Sap transporter system?

SapB functions as an integral membrane component of the Sap (sensitivity to antimicrobial peptides) ABC transporter system. It forms part of the membrane permease complex alongside SapC, creating the channel through which substrate transport occurs. SapB has sequence homology with the membrane components of the Opp and SpoOK transport systems from other bacteria . Together with SapC, these proteins create the transmembrane channel that facilitates the translocation of antimicrobial peptides (AMPs) from the periplasm to the bacterial cytoplasm .

The complete Sap transporter typically consists of five components:

  • SapA: Periplasmic binding protein that captures substrates

  • SapB and SapC: Transmembrane permease components

  • SapD and SapF: Cytoplasmic ATPase subunits that provide energy for transport

This organization allows the Sap system to function as a complete ATP-binding cassette (ABC) transporter, capable of actively transporting substrates against concentration gradients .

How does the SapB permease protein contribute to bacterial antimicrobial peptide resistance?

SapB plays a crucial role in bacterial defense against host antimicrobial peptides by forming the channel that internalizes these peptides. This internalization represents a novel mechanism of AMP resistance that differs from other strategies such as AMP efflux or exoprotease activity .

The transport of AMPs to the bacterial cytoplasm also appears to facilitate their degradation by cytoplasmic peptidases, effectively neutralizing their antimicrobial activity. This represents a sophisticated defense strategy where bacteria not only sequester AMPs away from their site of action but also enzymatically degrade them .

What is the structural organization of the SapB permease in the bacterial membrane?

SapB is predicted to be an integral membrane protein that spans the bacterial cytoplasmic membrane multiple times . While high-resolution structures specific to SapB are still emerging, structural insights can be inferred from homologous permease proteins in other ABC transporter systems.

The protein likely contains multiple transmembrane helices that form a substrate pathway across the membrane when assembled with its partner SapC. Together, these proteins create a portal through which AMPs can pass from the periplasm to the cytoplasm . The specific interactions between SapB and SapC create the functional transport channel with the appropriate substrate specificity for AMPs.

Transmembrane topology analysis suggests SapB contains hydrophobic segments that anchor it within the lipid bilayer, while hydrophilic regions likely participate in substrate recognition and interaction with other Sap components. The complex tertiary structure of the assembled SapBC permease enables it to selectively transport cationic peptides while maintaining membrane integrity .

What are the molecular mechanisms of SapB-mediated antimicrobial peptide transport?

The transport mechanism mediated by SapB involves a coordinated process requiring all components of the Sap transporter. Initially, the periplasmic binding protein SapA captures AMPs in the periplasm. SapA has been experimentally demonstrated to bind AMPs including chinchilla β-defensin-1 (an ortholog of human β-defensin-3) and LL-37 .

After AMP capture, SapA delivers the peptide substrate to the SapBC permease complex. Transport across the membrane through the SapBC channel requires energy provided by ATP hydrolysis catalyzed by the SapD and SapF ATPases . This energy input drives conformational changes in the permease complex that facilitate AMP translocation from periplasm to cytoplasm.

Evidence for this directional transport comes from fractionation experiments showing AMPs localize to cytoplasm-enriched fractions of intact cells following exposure to sub-lethal AMP concentrations. Time-course studies tracking AMP localization reveal differential kinetics:

  • hBD3 shows maximal import early (within 30 minutes) followed by decreasing detection over time

  • LL-37 accumulates during the first 2 hours post-exposure before gradually decreasing

These differences likely reflect variations in peptide structure, charge distribution, and susceptibility to cytoplasmic degradation. The degradation of internalized AMPs by cytoplasmic peptidases appears to be the final step in the resistance mechanism, reducing AMP concentration and preventing their membrane-disruptive activity .

How do mutations in the SapB permease affect antimicrobial peptide resistance and bacterial virulence?

Mutations in SapB have profound effects on bacterial resistance to AMPs and virulence. Deletion of the sapBC genes, which encode the permease components of the Sap transporter, leads to hypersensitivity to various antimicrobial peptides including human defensins, LL-37, protamine, melittin, and polymyxin B .

In transmission electron microscopy studies, sapBC mutants show striking accumulation of AMPs in the periplasm and at the inner membrane, but not in the cytoplasm, confirming the essential role of the permease in AMP internalization. This accumulation of AMPs at the cytoplasmic membrane in permease mutants correlates with increased membrane damage and cell death when exposed to AMPs .

In pathogenesis studies, Sap transporter mutations significantly attenuate bacterial virulence. For example, in Haemophilus influenzae, mutations in Sap transporter components reduce bacterial survival in mammalian infection models. In vivo experiments demonstrate that neutralization of host antimicrobial peptides reverses the attenuation of sapA mutants, confirming that the primary role of the Sap system in virulence is to counter host AMP activity .

Comparative virulence data from mouse infection models shows:

Bacterial StrainColonization EfficiencySurvival RateMembrane Integrity
Wild-typeHighHighMaintained
sapBC mutantSeverely reducedLowCompromised
sapA mutantModerately reducedModeratePartially compromised

These findings highlight the essential role of a functional SapB permease in bacterial pathogenesis and suggest that targeting this protein could be a viable strategy for antimicrobial development .

What is the relationship between SapB and other bacterial transporter systems?

SapB shares significant homology with permease components of other bacterial peptide transporters, particularly the oligopeptide permeases (Opp) and dipeptide permeases (Dpp) . Sequence analysis reveals that SapB belongs to the ATP-binding cassette (ABC) transporter family, specifically within the subfamily involved in peptide transport.

Comparative analysis with other transport systems indicates:

  • The SapB and SapC proteins have sequence homology with the membrane components of the Opp and SpoOK transport systems from Salmonella and Bacillus subtilis, respectively .

  • Unlike general nutrient oligopeptide transporters that handle a wide variety of peptide substrates, the Sap system appears specialized for cationic antimicrobial peptides .

  • The Sap system shares functional similarities with other AMP resistance mechanisms but represents a distinct strategy involving internalization rather than efflux. This contrasts with systems like MtrCDE or AcrAB-TolC that expel AMPs to the extracellular space .

This evolutionary relationship suggests that bacteria have adapted ancestral peptide transport machinery to serve specialized roles in antimicrobial defense. Understanding these relationships helps researchers predict SapB structure and function based on better-characterized homologous systems .

What are effective approaches for producing recombinant SapB protein for biochemical studies?

Producing functional recombinant SapB presents challenges due to its hydrophobic nature as an integral membrane protein. Several methodological approaches have proven successful:

Expression Systems:

  • E. coli-based expression: Using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Cell-free expression systems: Particularly useful for toxic membrane proteins

  • Yeast expression systems: P. pastoris can provide proper folding for complex membrane proteins

Optimization Strategies:

  • Use of fusion tags to enhance solubility (MBP, SUMO, or GFP tags)

  • Codon optimization for the expression host

  • Co-expression with SapC to stabilize the permease complex

  • Temperature reduction during induction (16-18°C)

  • Use of mild detergents for extraction (DDM, LMNG, or GDN)

Purification Approach:

  • Affinity chromatography using His-tagged constructs

  • Size exclusion chromatography to isolate properly folded protein

  • Reconstitution into nanodiscs or liposomes for functional studies

When developing expression constructs, researchers should consider that SapB functions as part of a complex with SapC. Co-expression of both proteins often yields better results than expressing SapB alone .

How can researchers assess SapB-mediated antimicrobial peptide transport in vitro?

Several experimental approaches can be used to measure SapB-mediated AMP transport:

1. Bacterial Fractionation and AMP Localization:
This approach involves exposing bacteria to fluorescently labeled or radiolabeled AMPs, followed by cell fractionation to separate periplasmic and cytoplasmic compartments. Quantification of labeled peptides in each fraction allows tracking of transport activity.

A validated fractionation protocol includes:

  • Membrane destabilization using osmotic shock or specialized buffer systems

  • Differential centrifugation to separate cellular compartments

  • Confirmation of fraction purity using compartment-specific marker proteins (e.g., β-lactamase for periplasm, SapD for cytoplasm)

2. Reconstituted Liposome-Based Transport Assays:
Purified SapB and SapC can be reconstituted into liposomes with co-purified SapD and SapF proteins to create a minimal transport system. Transport activity can be assessed by:

  • Entrapping fluorescence quenchers inside liposomes

  • Adding fluorescently labeled AMPs externally

  • Measuring fluorescence changes as peptides are transported into liposomes

3. Microscopy-Based Approaches:
Transmission electron microscopy with immunogold labeling can visualize AMP localization in bacterial cells. This approach has successfully demonstrated the accumulation of AMPs in the periplasm of sapBC mutants compared to wild-type bacteria .

4. Resistance Phenotype Assessment:
Functional transport can be indirectly assessed by measuring bacterial survival in the presence of AMPs. Complementation of sapBC mutants with recombinant constructs can confirm functionality of engineered SapB variants .

These approaches together provide a comprehensive toolkit for assessing SapB transport activity in various experimental contexts.

What genetic approaches are most effective for studying SapB function in bacterial systems?

Several genetic techniques have proven valuable for investigating SapB function:

1. Gene Deletion and Complementation:
Nonpolar deletion mutations of sapB or the entire sapBC locus have been successfully generated in various bacteria including Haemophilus influenzae. These are created through:

  • Homologous recombination techniques

  • Counterselectable markers for clean deletion

  • Complementation with wild-type or modified sapB genes to verify phenotype specificity

2. Site-Directed Mutagenesis:
Targeted mutations in conserved residues can identify amino acids critical for:

  • Membrane integration

  • Substrate binding

  • Interaction with other Sap components

  • Channel formation

3. Protein Fusion Approaches:

  • SapB-reporter fusions (GFP, mCherry) can track protein localization

  • Split protein complementation assays can investigate protein-protein interactions

  • Cysteine accessibility methods can probe transmembrane topology

4. Regulated Expression Systems:
Inducible promoters controlling sapB expression allow:

  • Titration of SapB levels to determine minimal functional concentrations

  • Temporal control to study kinetics of AMP resistance acquisition

  • Rescue experiments in deletion backgrounds

5. Interspecies Complementation:
Testing the ability of sapB homologs from different bacterial species to restore function in sapB mutants can reveal evolutionary conservation and functional requirements .

These genetic approaches, especially when combined with biochemical and structural methods, provide powerful tools for dissecting SapB function in bacterial antimicrobial peptide resistance.

How can structural studies of SapB advance our understanding of antimicrobial peptide transport?

Structural characterization of SapB remains a significant challenge but offers tremendous potential for advancing our understanding of AMP transport mechanisms. Recent advances in membrane protein structural biology, including cryo-electron microscopy (cryo-EM) and X-ray crystallography, provide promising approaches.

Research Priorities for Structural Studies:

  • Determination of SapB structure alone and in complex with SapC:
    Understanding the architecture of the complete permease complex would reveal the substrate pathway and potential gating mechanisms. This knowledge could inform the design of inhibitors targeting the permease complex .

  • Capturing different conformational states:
    ABC transporters typically cycle through multiple conformations during transport. Structures representing different states (e.g., inward-facing, outward-facing) would illuminate the transport mechanism .

  • Co-structures with antimicrobial peptide substrates:
    Visualizing how SapB/SapC interact with AMPs would reveal substrate specificity determinants and binding modes. This is particularly challenging due to the flexible nature of many AMPs .

Methodological Approaches:

  • Cryo-EM of detergent-solubilized or nanodisc-reconstituted SapBC complexes

  • X-ray crystallography using novel crystallization techniques like lipidic cubic phase

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Molecular dynamics simulations to model transport processes

Progress in structural studies would potentially resolve several outstanding questions, including how SapB achieves selectivity for cationic AMPs and how conformational changes couple ATP hydrolysis to substrate translocation .

What is the relationship between SapB-mediated AMP transport and other bacterial stress responses?

Emerging evidence suggests that SapB-mediated AMP transport is integrated with broader bacterial stress responses, forming part of a coordinated defense strategy:

  • Regulation by Two-Component Systems:
    Expression of the sap operon is upregulated during bacterial infection and in response to AMP exposure, suggesting integration with bacterial sensing systems that detect host-derived stressors .

  • Connections to Metabolic Adaptation:
    The Sap transporter may serve dual functions in some bacteria. For example, in Haemophilus influenzae, the Sap system has been implicated in both AMP resistance and heme utilization, suggesting a link between defense mechanisms and nutrient acquisition .

  • Cross-talk with Membrane Stress Responses:
    Bacteria employ multiple strategies to maintain membrane integrity under stress. Evidence suggests coordination between the Sap system and other membrane modification pathways that alter surface charge or lipid composition .

  • Integration with Virulence Programs:
    In pathogenic bacteria, sap expression correlates with virulence factor production, suggesting that AMP sensing via the Sap system may serve as a cue for virulence activation .

This integration highlights the sophisticated nature of bacterial defense systems and suggests that targeting SapB might have pleiotropic effects beyond simply increasing AMP susceptibility .

How do contradictory findings about SapB function across different bacterial species get reconciled?

Research on SapB function across different bacterial species has sometimes yielded seemingly contradictory results. Several frameworks help reconcile these findings:

  • Evolutionary Divergence in Substrate Specificity:
    While core transport mechanisms may be conserved, substrate preferences can diverge significantly. For example, some Sap transporters may preferentially transport specific classes of AMPs, while homologs in other species may have broader specificity .

  • Context-Dependent Function:
    The cellular environment impacts SapB function. Differences in membrane composition, coexpressed transporters, and cytoplasmic peptidases can all influence the apparent function of SapB in different bacteria .

  • Methodological Considerations:
    Apparent contradictions may arise from different experimental approaches:

    • Various AMP concentrations used (physiological vs. lethal)

    • Different readouts (survival, membrane integrity, AMP localization)

    • In vitro vs. in vivo studies

  • Multifunctionality:
    In some bacteria, the Sap system appears to serve dual roles. For instance, in Haemophilus influenzae, evidence suggests involvement in both AMP resistance and heme utilization, potentially explaining functional differences observed in different contexts .

A comprehensive framework for understanding SapB function should integrate these considerations, recognizing that bacterial transporters often evolve to serve species-specific adaptations while maintaining core mechanistic features .

What are promising strategies for targeting SapB to overcome bacterial antimicrobial resistance?

Given the critical role of SapB in bacterial defense against host AMPs, it represents an attractive target for novel antimicrobial strategies:

  • Permease Inhibitors:
    Small molecules that block the SapBC channel could prevent AMP internalization, leading to periplasmic accumulation and increased susceptibility to host defenses. Structure-based design approaches could yield specific inhibitors of the permease complex .

  • AMP Derivatives Resistant to Transport:
    Modified AMPs that maintain antimicrobial activity but resist SapBC-mediated transport could overcome this resistance mechanism. These would ideally maintain membrane-disruptive properties while evading recognition by SapA or transport through SapBC .

  • Combination Therapies:
    Pairing conventional antibiotics with Sap system inhibitors could enhance efficacy against resistant pathogens. This approach would be particularly valuable against organisms like non-typeable Haemophilus influenzae that rely heavily on Sap-mediated defense .

  • Targeting Regulatory Pathways:
    Inhibiting the regulatory systems that control sap operon expression could indirectly compromise AMP resistance. Understanding the transcriptional control of the sap operon is crucial for this approach .

  • Immunomodulatory Approaches:
    Enhancing host production of AMPs while simultaneously inhibiting bacterial Sap function could create a synergistic antimicrobial effect, particularly valuable in localized infections .

These strategies represent promising directions for translating our understanding of SapB function into novel therapeutic approaches against resistant bacterial infections .

How might advanced imaging techniques enhance our understanding of SapB dynamics in living bacteria?

Advanced imaging approaches offer exciting opportunities to study SapB dynamics in living bacterial cells:

  • Super-Resolution Microscopy:
    Techniques like STORM, PALM, or STED microscopy could visualize the distribution and clustering of SapB within the bacterial membrane at nanoscale resolution. This could reveal whether SapB localizes to specific membrane domains or forms higher-order complexes .

  • Single-Molecule Tracking:
    Tracking individual fluorescently labeled SapB molecules could reveal diffusion dynamics, complex assembly, and conformational changes during the transport cycle. This approach could answer questions about the stoichiometry and stability of the SapBC complex .

  • FRET-Based Sensors:
    Förster resonance energy transfer (FRET) pairs integrated into SapB and other Sap components could monitor protein-protein interactions and conformational changes in real time. This would be particularly valuable for understanding how the transport cycle progresses .

  • Correlative Light and Electron Microscopy:
    Combining fluorescence microscopy with electron microscopy could connect SapB localization with ultrastructural features, particularly during AMP challenge. This approach has already proven valuable in visualizing AMP accumulation in sapBC mutants .

  • Lattice Light-Sheet Microscopy:
    This technique offers exceptional resolution with reduced phototoxicity, allowing long-term imaging of bacterial cells. It could be used to track the dynamics of SapB-mediated AMP transport over extended periods .

These advanced imaging approaches would provide unprecedented insights into the spatial and temporal dynamics of SapB function in bacterial membranes, complementing biochemical and genetic studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.