Recombinant Peptide transport system permease protein sapC (sapC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. To ensure optimal stability, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are happy to accommodate specified tag types. Please inform us of your preferred tag, and we will prioritize its development.
Synonyms
sapC; STY1357; t1608; Peptide transport system permease protein SapC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Salmonella typhi
Target Names
sapC
Target Protein Sequence
MPYDSVYSEKRPPGTLRTAWRKFYSDAPAMVGLYGCAGLALLCIFGGWIAPYGIDQQFLG YQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFIVTLAATLCGLVLGVVA GATHGLRSAVLNHILDTLLSIPSLLLAIIVVAFAGPHLSHAMFAVWLALLPRMVRSVYSM VHDELEKEYVIAARLDGATTLNILWFAILPNITAGLVTEITRALSMAILDIAALGFLDLG AQLPSPEWGAMLGDALELIYVAPWTVMLPGAAITLSVLLVNLLGDGIRRAIIAGVE
Uniprot No.

Target Background

Function
SapC, the peptide transport system permease protein, plays a crucial role in a peptide intake transport system that contributes to resistance against antimicrobial peptides.
Database Links

KEGG: stt:t1608

STRING: 220341.STY1357

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Saposin C and how does it differ from bacterial sapC?

Saposin C (sapC) is a lysosomal, peripheral-membrane protein with liposome fusogenic capabilities. It displays high stability, protease resistance, and pH-dependent liposome binding activity . In contrast, the bacterial peptide transport system permease protein sapC is a transmembrane protein found in organisms like E. coli and Shigella flexneri, serving as part of the peptide transport system . These proteins share the "sapC" abbreviation but have distinct structures and functions. Saposin C contains a saposin fold characterized by α-helical structures that facilitate lipid interactions, while bacterial sapC contains multiple transmembrane domains with a full length of 296 amino acids in E. coli .

What expression systems are optimal for recombinant sapC production?

For recombinant Saposin C, standard expression in E. coli systems has proven effective, as the protein can be "over-expressed by recombinant methods and purified by standard chromatographic techniques" . For bacterial sapC, E. coli expression systems are also commonly used, with the addition of affinity tags (such as His-tags) to facilitate purification . When expressing Saposin C, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay require refolding for proper function
Mammalian cellsNative folding, post-translational modificationsLower yield, higher cost, longer production time
Insect cellsGood for complex proteins, higher yield than mammalianModerate cost, good compromise for folding

Purification typically employs chromatographic techniques, with concentration determination being challenging due to "the lack of Trp amino acid" in Saposin C .

How does pH affect sapC-lipid binding and experimental design?

Saposin C demonstrates pH-dependent liposome binding, with stronger binding observed at acidic pH levels compared to physiological pH . This pH dependence is critical for experimental design, as studies show that "SapC-DOPS targeting was inversely correlated with pH, i.e. binding was higher as media pH decreased" .

When designing experiments:

  • Buffer selection must account for this pH dependency

  • Physiological relevance must be balanced with optimal binding conditions

  • Surface modifications may be required for applications targeting physiological pH environments

Researchers have addressed this limitation by engineering "the sapC domain of the chimera to optimize liposome binding at pH close to physiological values as protein–lipid interactions are favored at acidic pH in the native protein" .

What methodologies are used to assess sapC-induced liposome fusion?

Dynamic light scattering (DLS) is the primary method used to assess the fusogenic capabilities of sapC and its variants. This technique measures particle size distribution, allowing researchers to monitor the increase in liposome size that occurs during fusion . The studies show that "sapC-PUMA and sapC-PUMA-DM induce liposome fusion, which indicates that the saposin fold tolerates non-conservative mutations and still retains its fusogenic capability" .

Additional methodologies include:

  • Fluorescence resonance energy transfer (FRET) to measure lipid mixing

  • Transmission electron microscopy for direct visualization of fused vesicles

  • Turbidity measurements to monitor changes in vesicle size

What mechanisms underlie sapC-DOPS cytotoxicity in cancer cells?

SapC-DOPS nanovesicles demonstrate selective cytotoxicity toward cancer cells through multiple mechanisms:

  • Preferential targeting: "SapC attached to the liposome lipid bilayer in the proteoliposomes can recognize cell populations with increased content in PS lipids due to its preference to bind negatively charged lipids" . Cancer cells typically express higher levels of phosphatidylserine (PS) on their outer membrane leaflet compared to normal cells .

  • Apoptosis induction: SapC-DOPS treatment leads to apoptotic cell death, as verified through:

    • DNA fragmentation analysis showing cells in sub-G0/G1 phase

    • Mitochondrial membrane potential (ΔΨm) collapse, measured using JC-1 dye

    • Dose-dependent decreases in cell viability measured via CCK-8 assays

The concentration-dependent cytotoxicity can be quantified using the formula: Growth inhibition (%) = (ODC-ODT)/ODC×100, where ODC and ODT are optical density values of control and treated samples, respectively .

How can sapC be engineered to enhance its therapeutic properties?

Engineering strategies to enhance sapC therapeutic properties include:

  • Surface modification for improved pH tolerance: "The sapC domain of the chimera has been engineered to optimize liposome binding at pH close to physiological values" . This involves "non-conservative mutations" that maintain fusogenic capability while altering binding properties.

  • Creation of fusion chimeras: The sapC-PUMA chimera links "sapC to a cell death-inducing peptide: the BH3 domain of the Bcl-2 protein PUMA" . This design enables dual functionality where:

    • The sapC domain facilitates targeting and membrane interaction

    • The PUMA BH3 domain interacts with prosurvival Bcl-xL to induce cell death

These engineering approaches demonstrate that "the properties of sapC proteoliposomes can be modified by engineering the protein surface and by the addition of small peptides as fusion constructs" .

What experimental protocols are essential for evaluating sapC-based nanotherapeutics?

Comprehensive evaluation of sapC-based nanotherapeutics requires multiple analytical approaches:

  • Physicochemical characterization:

    • Dynamic light scattering to confirm liposome fusion and determine size distribution

    • Solution NMR to verify structural integrity and molecular function

  • In vitro cytotoxicity assessment:

    • Cell viability assays (e.g., CCK-8) with concentration ranges of 0-128 μg/ml sapC

    • Apoptosis detection through DNA fragmentation analysis and mitochondrial membrane potential measurements

    • Flow cytometry to quantify cell binding and internalization at varying pH conditions

  • In vivo tumor targeting and efficacy:

    • Fluorescence imaging to assess tumor-selective targeting (using fluorescently labeled SapC-DOPS)

    • Xenograft tumor models to evaluate therapeutic efficacy

Standardized protocols typically employ SapC concentrations ranging from 8-50 μM for in vitro studies and measure outcomes after 48-72 hours of treatment .

How do sapC-PUMA chimeras compare with native sapC in terms of cytotoxicity?

SapC-PUMA chimeras demonstrate enhanced cytotoxicity compared to native sapC when delivered as proteoliposomes. Experimental data shows that "proteoliposomes with sapC-PUMA and sapC-PUMA-DM show increased cytotoxicity in glioblastoma cells relative to sapC-only proteoliposomes, which proves that the presence of PUMA BH3 has an additive effect in reducing cell viability" .

This enhanced cytotoxicity likely results from the dual-action mechanism:

  • SapC component facilitates cellular targeting and membrane interaction

  • PUMA BH3 domain interacts with prosurvival Bcl-xL proteins, triggering apoptotic pathways

The sapC-PUMA-DM (double mutant) variant maintains this enhanced cytotoxicity while also demonstrating improved binding at physiological pH conditions .

What considerations are important for bacterial sapC recombinant protein expression?

When working with bacterial peptide transport system permease protein sapC, researchers should consider:

  • Protein characteristics and handling:

    • Full-length protein consists of 296 amino acids

    • Contains multiple transmembrane domains requiring appropriate detergents for stability

    • Requires careful buffer selection for solubilization and purification

  • Storage and stability:

    • Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

    • Avoid repeated freeze-thaw cycles

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

  • Quality control:

    • Verify purity via SDS-PAGE (>90% purity is standard)

    • Confirm activity through functional assays specific to transport properties

What analytical techniques are most effective for studying sapC-lipid interactions?

Several analytical techniques provide complementary information about sapC-lipid interactions:

  • Solution NMR: Enables detailed analysis of protein structure and dynamics during lipid binding. This technique has been successfully used to demonstrate that "sapC-PUMA is functional at the molecular level by fusing liposomes and by interacting with prosurvival Bcl-xL" .

  • Dynamic Light Scattering (DLS): Provides information about particle size distribution and fusion events. DLS confirms that both sapC-PUMA and sapC-PUMA-DM "induce liposome fusion, which indicates that the saposin fold tolerates non-conservative mutations" .

  • Flow Cytometry: Quantifies binding of fluorescently labeled sapC preparations to cells under different pH conditions. Studies show that "SapC-DOPS-CMV targeting was inversely correlated with pH" .

  • Fluorescence Microscopy: Visualizes the interaction and localization of fluorescently labeled sapC with model membranes or cellular targets.

How should researchers address the challenge of sapC concentration determination?

Accurate determination of sapC concentration presents a unique challenge due to "the lack of Trp amino acid" , which limits the use of UV absorbance at 280 nm for protein quantification. Researchers have developed alternative strategies:

  • NMR signal intensity comparison: "NMR spectra of sapC-PUMA and sapC were acquired twice for each protein and overlaid to determine the concentration of sapC based on that of sapC-PUMA using NMR signal intensity of amino acids Glu49 and Cys75 from the sapC region, which are isolated" .

  • Alternative spectroscopic methods: Modified Bradford or BCA assays can be calibrated specifically for sapC.

  • Amino acid analysis: For absolute quantification, though more resource-intensive.

For consistent experimental design, researchers prepared specific protein concentrations: "8 μM, 16 μM, 24 μM, 28 μM, 32 μM, and 40 μM for killing activity comparison of sapC and sapC-PUMA; and 10 μM, 20 μM, 30 μM, 35 μM, 40 μM, and 50 μM for killing activity comparison of sapC-PUMA and sapC-PUMA-DM" .

What critical controls are necessary for sapC-based cancer therapy experiments?

Robust experimental design for sapC-based cancer therapy studies requires several critical controls:

  • Liposome-only controls: To distinguish effects of the lipid component from the protein component

  • Protein-only controls: To assess activity of sapC without liposome presentation

  • pH controls: Given the pH-dependency of sapC-lipid binding, experiments should include controls at various pH values

  • Cell-type specificity controls: Comparative studies using:

    • Cancer cells with varying PS exposure levels

    • Normal cell counterparts to demonstrate selective toxicity

    • Cancer cells pre-treated with PS-masking agents

  • Mechanism validation controls:

    • Apoptosis inhibitors to confirm the cell death pathway

    • Specific blocking antibodies or competitors for receptor-mediated uptake

These controls ensure that observed effects can be specifically attributed to the sapC-liposome interaction and its proposed mechanism of action.

What emerging applications exist for engineered sapC variants?

Engineered sapC variants present exciting opportunities for expanded therapeutic applications:

  • Multi-functional chimeras: Beyond the sapC-PUMA chimera, future designs might incorporate:

    • Imaging agents for theranostic applications

    • Additional therapeutic peptides targeting complementary pathways

    • Cell-penetrating peptides to enhance intracellular delivery

  • Enhanced tissue targeting: Engineering sapC to recognize specific tissue markers beyond PS exposure could enable more precise targeting of:

    • Brain tumors with blood-brain barrier penetration capability

    • Metastatic lesions with specific surface signatures

    • Cancer stem cell populations

  • Immunomodulatory applications: SapC variants could potentially be engineered to:

    • Deliver immunostimulatory molecules to the tumor microenvironment

    • Enhance antigen presentation for cancer vaccines

    • Modulate tumor-associated macrophage polarization

The proven ability to engineer sapC while maintaining its essential functions provides a platform for these diverse applications.

How might combination therapies incorporate sapC-based nanotherapeutics?

SapC-based nanotherapeutics could enhance conventional cancer treatments through strategic combinations:

  • With chemotherapy: SapC-DOPS could potentially:

    • Increase tumor cell sensitivity to chemotherapeutic agents

    • Provide targeted delivery of chemotherapeutic payloads

    • Overcome resistance mechanisms through complementary cell death pathways

  • With radiotherapy: Potential synergies include:

    • Radiosensitization of tumor cells

    • Targeting of hypoxic regions resistant to radiation

    • Enhanced immune recognition of radiation-damaged cells

  • With immunotherapy: SapC-DOPS could:

    • Increase tumor immunogenicity through immunogenic cell death

    • Deliver immune checkpoint inhibitors to the tumor microenvironment

    • Modulate suppressive immune cell populations

Systematic investigations of these combinations would require careful timing and dosing studies to maximize therapeutic synergy while minimizing toxicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.