Recombinant Mycobacterium tuberculosis Peptidoglycan-binding protein ArfA (arfA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Acid Stress and Pathogenicity

ArfA is encoded by the arf operon (arfA, arfB, arfC), exclusive to pathogenic mycobacteria (e.g., M. tuberculosis, M. bovis). Its functions include:

  • Peptidoglycan binding: Specifically recognizes diaminopimelate (DAP)-type peptidoglycan via interactions with m-DAP residues, distinguishing it from lysine-type peptidoglycan .

  • Acid stress adaptation: Stabilizes the cell envelope under acidic conditions, facilitating ammonia secretion to neutralize the environment .

Table 1: ArfA Functional Attributes

PropertyDetails
Peptidoglycan specificityDAP-type (not Lys-type) via conserved arginines (R241, R247)
Acid-stress mechanismpH-dependent structural ordering enhances peptidoglycan binding
Pathogenicity linkOperon found exclusively in tuberculosis-associated mycobacteria

Recombinant ArfA Production

Recombinant ArfA is produced for structural and functional studies. Key specifications include:

Research Applications and Findings

  • Peptidoglycan interaction assays: Recombinant ArfA-C domain binds polymeric M. tuberculosis peptidoglycan and soluble intermediates (e.g., UMDP/Park’s nucleotide) .

  • Mutational studies: The D236A mutation in the C domain does not disrupt peptidoglycan binding, indicating conformational flexibility .

  • Therapeutic potential: ArfA’s role in acid stress and cell wall integrity makes it a candidate for anti-tuberculosis drug development .

Table 3: Key Binding Assay Results

SubstrateBinding AffinityKey Residues Involved
M. tuberculosis PGTight association (insoluble fraction) R241, R247, Y263, Q264, D236
UMDP (soluble intermediate)Specific interaction Same as above
Lys-type PGNo binding

Implications for Tuberculosis Research

ArfA bridges acid stress resistance and cell wall physiology, offering insights into:

  • Bacterial persistence: Enhances survival in host macrophages by maintaining cell envelope integrity under acidic stress .

  • Drug targeting: Disruption of ArfA-PG interactions could weaken M. tuberculosis during infection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Target Names
arfA
Target Protein Sequence
MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL GSVNPIASNATPEGRAKNRRVEIVVN
Uniprot No.

Q&A

What is ArfA in Mycobacterium tuberculosis and what is its significance?

ArfA (Rv0899) is a membrane protein encoded by an operon (rv0899-rv0901) that is required for supporting mycobacterial growth in acidic environments. It has been identified as the first peptidoglycan-binding protein in M. tuberculosis . The arf operon (ammonia release facilitator) is found exclusively in organisms associated with tuberculosis (M. tuberculosis, M. bovis) and other mycobacterial diseases (M. marinum, M. ulcerans, M. kansasii), suggesting a potential role in pathogenicity . This restricted distribution makes ArfA an attractive candidate for the development of targeted antimycobacterial agents.

The significance of ArfA lies in its dual function: acid stress protection and peptidoglycan binding. This suggests an important link between the acid stress response and the physical-chemical properties of the mycobacterial cell wall . Understanding this relationship is critical for comprehending how M. tuberculosis adapts to the acidic environment within macrophages during infection.

What is the structural organization of ArfA?

ArfA forms three independently structured domains, each with distinct characteristics and functions . Previous research has established the high-resolution structures of its central domain (B domain) and C-terminal domain (C domain). The C domain is particularly notable as it shares significant sequence homology with the OmpA-like family of peptidoglycan-binding domains .

The C domain of ArfA adopts the characteristic βαβαβαβ core structure typical of the OmpA-like family and exhibits pH-dependent conformational dynamics . At neutral pH, the structure shows significant heterogeneity, while at acidic pH, it adopts a more ordered configuration. This pH-dependent behavior likely relates to ArfA's function in acid-stress response.

How does ArfA interact with mycobacterial peptidoglycan?

ArfA associates tightly with polymeric peptidoglycan isolated from M. tuberculosis and also binds to soluble peptide intermediates of peptidoglycan biosynthesis . This interaction occurs through its C-terminal domain, which contains a specific binding site for peptidoglycan recognition.

The molecular basis for peptidoglycan recognition involves five highly conserved ArfA residues, including two key arginines that establish specificity for diaminopimelate (DAP)-type peptidoglycan over lysine (Lys)-type peptidoglycan . This specificity is important as DAP-type peptidoglycan is characteristic of gram-negative bacteria and mycobacteria, while Lys-type is found in most gram-positive bacteria.

When tested experimentally, significant amounts of ArfA-bc, ArfA-c, and ArfA-c(D236A) separate with the insoluble fraction after centrifugation when incubated with M. tuberculosis peptidoglycan, confirming this binding activity .

What experimental methods are most effective for studying ArfA-peptidoglycan interactions?

For studying ArfA-peptidoglycan interactions, several complementary experimental approaches are recommended:

Peptidoglycan binding assays: The most direct method involves incubating purified recombinant ArfA domains with isolated M. tuberculosis peptidoglycan, followed by centrifugation to separate bound (pellet) and unbound (supernatant) fractions. Successful binding is indicated by the presence of ArfA in the pellet fraction after SDS-PAGE analysis .

NMR spectroscopy: For detailed structural characterization, nuclear magnetic resonance (NMR) can reveal the high-resolution structure and dynamics of the C domain and its interactions with peptidoglycan components. This technique is particularly valuable for observing pH-dependent conformational changes in ArfA .

Mutagenesis studies: Site-directed mutagenesis of the five highly conserved residues, especially the two key arginines involved in DAP recognition, followed by binding assays, can validate the specific amino acids responsible for peptidoglycan binding specificity .

Surface plasmon resonance (SPR): This technique can provide quantitative binding kinetics data for ArfA-peptidoglycan interactions under various pH conditions, helping to correlate structural dynamics with binding affinity.

How can researchers investigate the pH-dependent conformational dynamics of ArfA's C domain?

The pH-dependent conformational dynamics of ArfA's C domain require specialized techniques for proper investigation:

NMR spectroscopy at varying pH: Conduct NMR experiments at different pH values (ranging from pH 5.0 to 7.5) to observe changes in chemical shifts and peak intensities that reflect structural rearrangements. This will allow mapping of which regions become more ordered at acidic pH .

Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can reveal differences in structural flexibility at various pH conditions by measuring the rate at which backbone amide hydrogens exchange with deuterium from the solvent.

Circular dichroism (CD) spectroscopy: Use CD to monitor secondary structure content across a pH gradient, providing insights into global conformational changes.

Molecular dynamics simulations: Computational approaches can model the pH-dependent structural transitions based on protonation states of key residues, complementing experimental data.

Experimental design considerations:

pH ConditionExpected ArfA-C Domain BehaviorRecommended Analysis Techniques
pH 5.0-5.5More ordered structureNMR, HDX-MS, CD
pH 6.0-6.5Transition stateTime-resolved techniques, temperature variation studies
pH 7.0-7.5Significant heterogeneityNMR with relaxation measurements, single-molecule techniques

When designing these experiments, researchers should include appropriate controls, such as pH-insensitive protein domains, and carefully monitor solution conditions to ensure buffer effects don't confound the results.

What are the key considerations for designing mutagenesis studies to characterize the peptidoglycan binding site of ArfA?

When designing mutagenesis studies to characterize the peptidoglycan binding site of ArfA, researchers should consider:

Target residue selection: Focus on the five highly conserved residues identified in previous research, particularly the two key arginines that establish specificity for DAP-type peptidoglycan . Additionally, perform sequence alignment with other OmpA-like domains to identify other potentially important residues.

Mutation strategy:

  • Employ both alanine scanning (to remove side chain functionality) and conservative substitutions (to alter chemical properties while maintaining steric bulk)

  • Create single, double, and multiple mutations to assess cooperative effects

  • Consider charge-reversal mutations for electrostatic interactions

Binding assay workflow:

  • Express and purify wild-type and mutant ArfA domains under identical conditions

  • Verify proper folding using circular dichroism or limited proteolysis

  • Perform comparative binding assays with isolated M. tuberculosis peptidoglycan

  • Quantify binding through densitometry of SDS-PAGE bands or other quantitative methods

  • Calculate relative binding affinities compared to wild-type protein

Controls and validations:

  • Include non-binding domains as negative controls

  • Test binding to both DAP-type and Lys-type peptidoglycan to confirm specificity determinants

  • Validate structural integrity of mutants through thermal stability assays

How can researchers distinguish between the roles of different ArfA domains in mycobacterial acid resistance?

Distinguishing between the roles of different ArfA domains in acid resistance requires a multi-faceted experimental approach:

Domain deletion studies: Generate recombinant M. tuberculosis strains expressing ArfA variants lacking specific domains (N-terminal, central B domain, or C-terminal domain) to determine which domains are essential for acid resistance.

Complementation assays: In an ArfA-knockout strain, reintroduce individual domains or domain combinations to identify which can restore acid resistance function.

pH-dependent growth assays: Compare growth curves of wild-type and domain-deletion strains across a range of pH conditions (pH 5.0-7.0) to quantify the contribution of each domain to acid resistance.

Domain swap experiments: Replace ArfA domains with corresponding domains from proteins with similar structure but different function to identify specific features required for acid resistance.

Peptidoglycan binding correlation: Design experiments that specifically measure both peptidoglycan binding and acid resistance in parallel to determine if these functions are mechanistically linked or independent.

What approaches can be used to study the relationship between ArfA and ammonia secretion in M. tuberculosis?

The relationship between ArfA and ammonia secretion in M. tuberculosis can be investigated through these methodological approaches:

Ammonia quantification assays: Measure ammonia production in wild-type, ArfA-knockout, and complemented strains under various pH conditions using colorimetric assays or ammonia-selective electrodes .

Transcriptional analysis: Employ RNA-Seq or qRT-PCR to analyze the expression of the complete arf operon (arfA, arfB, arfC) under acid stress conditions to determine if ammonia secretion genes are co-regulated with ArfA.

Protein-protein interaction studies: Investigate whether ArfA physically interacts with other proteins in the ammonia secretion pathway using techniques such as:

  • Co-immunoprecipitation

  • Bacterial two-hybrid assays

  • Cross-linking followed by mass spectrometry

Metabolomic profiling: Compare the metabolite profiles of wild-type and ArfA-deficient strains during acid stress to identify shifts in nitrogen metabolism related to ammonia production.

Experimental design matrix:

Research QuestionMethodControlsExpected Outcome
Is ArfA directly involved in ammonia transport?Liposome reconstitution with purified ArfAEmpty liposomes, liposomes with known transportersAmmonia flux measurements
Does peptidoglycan binding affect ammonia secretion?Compare ammonia production in binding-deficient mutantsWild-type ArfA, unrelated peptidoglycan-binding proteinCorrelation between binding capacity and ammonia levels
Are all three arf operon genes required for ammonia secretion?Single and combinatorial gene knockoutsComplete operon deletion, individual complementationIdentification of essential components

What are the optimal conditions for expressing and purifying recombinant ArfA for structural studies?

For optimal expression and purification of recombinant ArfA, researchers should consider:

Expression system selection:

  • For full-length ArfA: Consider mycobacterial expression systems due to potential membrane association challenges

  • For individual domains: E. coli BL21(DE3) or similar strains with codon optimization for mycobacterial sequences

  • For structural studies of C domain: Isotopic labeling (15N, 13C) for NMR studies may be necessary

Solubility considerations:

  • Full-length ArfA likely requires detergent solubilization due to membrane association

  • The C domain can be expressed as a soluble protein for binding and structural studies

  • Fusion tags (MBP, SUMO) may improve solubility of certain domains

Purification strategy:

  • Initial capture: Affinity chromatography (His-tag, GST)

  • Intermediate purification: Ion exchange chromatography

  • Final polishing: Size exclusion chromatography

  • For membrane-associated constructs: Include appropriate detergents throughout

Quality control metrics:

  • Homogeneity: >95% purity by SDS-PAGE

  • Monodispersity: Single peak by size exclusion chromatography

  • Proper folding: Circular dichroism spectroscopy

  • Activity validation: Peptidoglycan binding assay

How can researchers investigate functional differences between M. tuberculosis ArfA and related proteins in other mycobacterial species?

Investigating functional differences between M. tuberculosis ArfA and related proteins in other mycobacterial species requires a comparative approach:

Sequence and structural analysis:

  • Perform multiple sequence alignment of ArfA homologs from M. tuberculosis, M. bovis, M. marinum, M. ulcerans, and M. kansasii

  • Identify conserved and variable regions, focusing on peptidoglycan-binding residues

  • Generate homology models if experimental structures are unavailable

Recombinant protein studies:

  • Express and purify ArfA homologs from different species

  • Compare peptidoglycan binding affinities using consistent assay conditions

  • Analyze pH-dependent conformational changes across homologs

Heterologous complementation:

  • Create cross-species complementation strains by expressing ArfA variants from different mycobacteria in an M. tuberculosis ArfA-knockout background

  • Test acid resistance, ammonia secretion, and growth phenotypes

Domain swap experiments:

  • Generate chimeric proteins with domains from different species to identify species-specific functional regions

Correlation with pathogenicity:

  • The arf operon is exclusively found in pathogenic mycobacteria, suggesting specific relevance to virulence

  • Compare expression patterns and regulation across species with different host tropisms and disease manifestations

How should researchers interpret contradictory findings regarding ArfA's role in mycobacterial virulence?

When facing contradictory findings regarding ArfA's role in virulence, researchers should systematically analyze potential sources of variation:

Strain differences:

  • Different laboratory strains of M. tuberculosis may show genetic drift affecting ArfA function

  • Clinical isolates may harbor polymorphisms in the arf operon affecting phenotypes

Methodological variations:

  • Infection models: Different cell lines, animal models, or infection conditions may produce varying results

  • Gene knockout strategies: Polar effects on adjacent genes could confound interpretation

Environmental factors:

  • Growth conditions prior to infection experiments may pre-condition bacterial physiology

  • Host cell activation status can dramatically affect intracellular survival outcomes

Approach to resolving contradictions:

  • Direct comparison studies using identical experimental conditions

  • Multi-laboratory validation of key findings

  • Meta-analysis of published results to identify patterns in experimental variables

  • Combination of in vitro, ex vivo, and in vivo approaches to build a comprehensive picture

What statistical approaches are most appropriate for analyzing ArfA binding affinity data?

For analyzing ArfA binding affinity data, appropriate statistical approaches include:

For equilibrium binding data:

  • Nonlinear regression to fit binding curves (Kd determination)

  • Scatchard or Hill plots for cooperative binding analysis

  • Statistical comparison of Kd values using extra sum-of-squares F test

For kinetic binding data:

  • Global fitting of association and dissociation phases

  • Comparison of kon and koff rates across conditions or mutants

  • Arrhenius plots to determine activation energies of binding

For comparative binding studies:

  • ANOVA with appropriate post-hoc tests for comparing multiple variants

  • Paired t-tests for direct comparisons between wild-type and mutant proteins

  • Bootstrap resampling for robust confidence interval estimation

Data presentation recommendations:

  • Include both raw data and fitted curves

  • Report both means and measures of variability (SD or SEM)

  • Present replicate measurements from independent protein preparations

  • Include appropriate controls in all graphical representations

What are promising strategies for developing inhibitors targeting ArfA-peptidoglycan interactions?

Developing inhibitors targeting ArfA-peptidoglycan interactions offers a novel approach to tuberculosis therapeutics, with several promising strategies:

Structure-based drug design:

  • Use the high-resolution structure of ArfA's C domain to identify druggable pockets

  • Perform virtual screening against the peptidoglycan binding site

  • Design peptidomimetics based on the DAP-containing peptidoglycan stem structure

Fragment-based screening:

  • Screen fragment libraries against the C domain using NMR or thermal shift assays

  • Grow or link promising fragments to develop high-affinity ligands

  • Focus on compounds that disrupt the key arginine interactions with DAP

Peptide-based inhibitors:

  • Design synthetic peptides mimicking the peptidoglycan stem peptide

  • Incorporate non-natural amino acids for improved stability and specificity

  • Develop stapled peptides to lock conformation for optimal binding

Allosteric modulators:

  • Target the pH-sensing regions that control conformational dynamics

  • Identify compounds that lock ArfA in its inactive conformation

Experimental validation pipeline:

  • Primary screening: In vitro binding disruption assays

  • Secondary validation: Cellular assays for acid resistance

  • Mechanism confirmation: Structural studies of inhibitor-protein complexes

  • Efficacy testing: Intracellular and animal infection models

How might systems biology approaches enhance our understanding of ArfA's role in the mycobacterial stress response network?

Systems biology approaches can provide a comprehensive understanding of ArfA's role within the broader mycobacterial stress response network:

Multi-omics integration:

  • Transcriptomics: Identify genes co-regulated with the arf operon under acid stress

  • Proteomics: Map interaction partners of ArfA using proximity labeling or pull-down approaches

  • Metabolomics: Characterize metabolic shifts associated with ArfA function, particularly nitrogen metabolism

Network analysis:

  • Construct protein-protein interaction networks centered on ArfA

  • Identify regulatory nodes that control ArfA expression

  • Map epistatic relationships between ArfA and other stress response pathways

Mathematical modeling:

  • Develop dynamic models of acid stress response incorporating ArfA function

  • Simulate the effects of ArfA perturbation on cellular homeostasis

  • Predict emergent properties of the system under various stress conditions

Single-cell approaches:

  • Investigate cell-to-cell variability in ArfA expression and function

  • Correlate ArfA activity with bacterial survival in heterogeneous environments

  • Track real-time responses to pH fluctuations at the single-cell level

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.