Recombinant Perognathus flavus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Taxonomy and Distribution

Perognathus flavus, commonly known as the silky pocket mouse, is one of the smallest rodents in North America. It belongs to the family Heteromyidae, which includes pocket mice, kangaroo rats, and kangaroo mice . The species is distributed across western and southwestern North America, ranging from South Dakota in the north to central Mexico in the south, and from Colorado in the west to Texas in the east .

Recent molecular studies have revealed significant genetic diversity within what was previously considered a single species, with mitochondrial DNA analyses identifying several distinct lineages that may represent separate species or subspecies . This genetic diversity makes P. flavus an intriguing subject for evolutionary studies, with its mitochondrial genes providing valuable insights into rodent diversification patterns.

Physical Characteristics and Ecology

The silky pocket mouse is characterized by its diminutive size, with the following physical measurements :

  • Total length: 95-118 mm

  • Tail length: 41-58 mm

  • Hindfoot length: 12-18 mm

  • Weight: 6-9 g

This species has remarkably soft, silky fur, short ears, and a sparsely haired tail. The dorsal coloration is pinkish buff with some black hairs intermixed, while the ventral surface is pure white. A distinctive feature is the conspicuous postauricular patch of buffy fur, which is typically twice as large as the ear itself .

Cellular Function

Cytochrome c oxidase subunit 2 serves as an essential component of Complex IV (cytochrome c oxidase) in the mitochondrial electron transport chain. This complex is crucial for cellular respiration, facilitating the transfer of electrons from cytochrome c to molecular oxygen, coupled with proton pumping across the inner mitochondrial membrane . The protein contains metal ion binding domains, which are critical for its electron transfer functionality .

Evolutionary Applications

The MT-CO2 gene has proven particularly valuable for evolutionary studies due to several characteristics:

  1. It evolves at a moderate rate, making it suitable for examining relationships at various taxonomic levels .

  2. As part of the mitochondrial genome, it is maternally inherited and does not undergo recombination, simplifying phylogenetic analyses .

  3. It contains both conserved and variable regions, allowing for comparative studies across diverse mammalian lineages .

Researchers have utilized MT-CO2 sequences, often in combination with other mitochondrial genes such as cytochrome b and cytochrome oxidase subunit 3, to investigate evolutionary relationships among heteromyid rodents, including the Perognathus genus . These studies have revealed significant insights into the diversification of pocket mice across arid grasslands and intermontane basins in western North America .

Expression Systems and Purification

The recombinant Perognathus flavus MT-CO2 protein is typically produced using bacterial expression systems, with Escherichia coli being a common host. Based on similar recombinant mitochondrial proteins, the production process likely involves:

  1. Cloning of the MT-CO2 gene into a suitable expression vector

  2. Transformation of the host bacterial cells

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography, typically via a histidine tag

The commercially available protein is often supplied with an N-terminal histidine tag to facilitate purification and downstream applications .

Phylogenetic and Evolutionary Studies

The primary application of recombinant Perognathus flavus MT-CO2 is in evolutionary biology and phylogenetics. Researchers have used MT-CO2 sequences to investigate:

  1. Diversification patterns within the Perognathus flavus species group across western North America, revealing major lineage splits dating to the late Miocene era

  2. Relationships among heteromyid rodents, contributing to revised taxonomic classifications

  3. Comparative analyses of mitochondrial evolution across mammalian lineages

Table 1: Genetic divergence values (%) between major clades within the Perognathus flavus species group based on mitochondrial DNA sequences including MT-CO2.

Clade12345
1. flavus Colorado Plateau-5.68.48.59.2
2. flavus Northern Chihuahuan Desert5.6-9.29.710.0
3. flavus Southern Chihuahuan Desert8.49.2-9.710.6
4. flavus Great Plains8.59.79.7-10.6
5. flavus Tehuacan Valley9.210.010.610.6-

Note: This table shows selected values adapted from a larger divergence matrix

Immunological Applications

The recombinant protein can also serve as an antigen for antibody production, enabling:

  1. Development of specific antibodies for immunohistochemistry and immunoblotting

  2. Creation of ELISA-based detection systems

  3. Immunological studies focusing on mitochondrial proteins

Product Details

Recombinant Perognathus flavus MT-CO2 is commercially available from several suppliers with the following specifications:

  • Protein length: Full-length (226 amino acids)

  • UniProt accession: Q37595

  • Form: Typically provided as a lyophilized powder

  • Purity: Generally >90% as determined by SDS-PAGE

  • Tag: Commonly includes an N-terminal histidine tag

  • Price range: $1,515.00 to $1,574.00 as of early 2025

Applications According to Manufacturers

According to product documentation, the recombinant protein is suitable for:

  1. Use as a positive control in immunoassays

  2. Protein-protein interaction studies

  3. Enzymatic activity assays

  4. Structural studies

  5. ELISA development

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Perognathus flavus (Silky pocket mouse)
Target Names
Target Protein Sequence
MAYPLQLGLQDATSPIMEELTSFHDHTLMIVFLISTLVLYIISLMLTTKLTHTSTMDAQE IETIWTILPAIILIMIALPSLRVLYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLSFDS YMVNTTDLKPGDLRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVSSSRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFEAWSASM
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a process crucial for cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work collaboratively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) consisting of heme a3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its biological function?

Cytochrome c oxidase subunit 2 (MT-CO2) is a protein component of the respiratory chain Complex IV, which is the terminal enzyme of the mitochondrial electron transport chain. It functions in transferring electrons from cytochrome c to molecular oxygen, contributing to ATP synthesis through oxidative phosphorylation. In Perognathus flavus (Silky pocket mouse), this protein is encoded by the mitochondrial genome and consists of 226 amino acids . The functional protein contains copper centers and serves as a crucial component in cellular respiration.

What are appropriate storage and handling conditions for recombinant MT-CO2?

Recombinant Perognathus flavus MT-CO2 should be stored in Tris-based buffer with 50% glycerol, which helps maintain protein stability. For long-term storage, the protein should be kept at -20°C or preferably -80°C to prevent degradation. Working aliquots can be maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity . When handling the protein, it's advisable to work on ice when possible and use sterile techniques to prevent contamination.

How does MT-CO2 differ across rodent species?

MT-CO2 exhibits variable evolutionary rates across different rodent species, which impacts its utility for phylogenetic analyses. Studies comparing MT-CO2 sequences across eutherian mammals, particularly focusing on rodents and artiodactyls, have shown that this gene demonstrates lineage-specific rate variations . These differences are influenced by:

FactorImpact on MT-CO2 Evolution
Base composition biasAffects codon usage and apparent phylogenetic relationships
Transition/transversion ratiosVaries across rodent lineages, influencing mutation rates
Selective constraintsDifferent across codon positions, with second positions most conserved
Homoplasy levelsParticularly high at third codon positions, complicating phylogenetic inference

These variations make MT-CO2 both challenging and valuable for studying evolutionary relationships among rodent species .

How can MT-CO2 be used in conjunction with other molecular markers for more robust phylogenetic analyses?

For robust phylogenetic analyses, MT-CO2 should be used in combination with other molecular markers that have complementary evolutionary characteristics. Research has demonstrated that MT-CO2 and cytochrome b (COB) genes show different patterns of evolution and can yield inconsistent phylogenetic hypotheses when analyzed independently . A methodological approach to address this includes:

  • Combining MT-CO2 with nuclear genes that evolve at slower rates to resolve deeper evolutionary relationships

  • Implementing partitioned analyses that account for different evolutionary models across genes

  • Utilizing character weighting schemes that account for transition/transversion biases

  • Applying maximum likelihood or Bayesian approaches that can accommodate heterogeneous evolutionary rates

When implementing these approaches, researchers should:

  • Test for congruence between gene trees derived from different markers

  • Assess support values (bootstrap, posterior probabilities) across analyses

  • Consider the impact of different analytical methods on tree topology

  • Account for potential mitochondrial introgression or lineage sorting

This integrated approach can overcome the phylogenetic inconsistencies observed when using MT-CO2 alone .

What methodological challenges exist in analyzing MT-CO2 sequence data for phylogenetic reconstruction?

Analysis of MT-CO2 for phylogenetic reconstruction presents several methodological challenges that researchers must address:

  • Nucleotide Substitution Rate Heterogeneity: MT-CO2 shows variable evolutionary rates across lineages, particularly between different mammalian orders, which can lead to long-branch attraction artifacts .

  • Base Composition Bias: Differences in GC content across species can result in artificial groupings of taxa with similar base compositions rather than true evolutionary relationships.

  • Codon Position Effects: The three codon positions evolve at different rates and under different constraints, requiring position-specific models:

Codon PositionEvolutionary RateConstraint LevelHomoplasy Risk
FirstIntermediateHighModerate
SecondSlowestHighestLow
ThirdFastestLowestHigh

To address these challenges, researchers should consider:

  • Excluding or downweighting third codon positions in analyses of distantly related taxa

  • Implementing codon-based models rather than nucleotide models

  • Testing for saturation before conducting phylogenetic analyses

  • Using mixture models that can accommodate heterogeneous evolutionary processes

How do post-translational modifications affect recombinant MT-CO2 function compared to native protein?

Recombinant MT-CO2 may lack critical post-translational modifications (PTMs) present in the native protein, potentially affecting functional studies. While specific data on Perognathus flavus MT-CO2 PTMs is limited, mitochondrial proteins typically undergo modifications including:

  • Oxidative modifications: Affecting cysteine residues crucial for copper binding

  • Phosphorylation: Potentially regulating protein-protein interactions

  • Proteolytic processing: Removal of targeting sequences

Methodological approaches to assess these differences include:

  • Mass spectrometry analysis of native versus recombinant protein to identify PTM differences

  • Activity assays comparing enzyme kinetics between native and recombinant forms

  • Structural analysis using circular dichroism or thermal shift assays to detect conformational differences

Researchers should consider implementing in vitro modification systems or utilizing eukaryotic expression systems that can perform mammalian-like post-translational processing to obtain more functionally relevant recombinant protein for experimental studies.

What expression systems are optimal for producing functional recombinant Perognathus flavus MT-CO2?

The choice of expression system significantly impacts the yield, solubility, and functionality of recombinant MT-CO2. Based on protein characteristics, recommended systems include:

Expression SystemAdvantagesLimitationsOptimization Strategies
Mammalian cellsNative-like folding and PTMsHigher cost, lower yieldCo-expression with chaperones
Insect cellsGood for membrane proteinsModerate costBaculovirus expression optimization
Yeast (P. pastoris)High yield, eukaryotic PTMsGlycosylation patterns differMethanol induction optimization
E. coliCost-effective, high yieldLimited PTMs, inclusion body riskFusion tags, reduced temperature

For MT-CO2, which contains transmembrane domains and requires proper folding, mammalian or insect cell systems are generally preferred. If using E. coli, expression should be optimized by:

  • Using specialized strains designed for membrane proteins

  • Incorporating solubility tags (MBP, SUMO, Trx)

  • Expressing at lower temperatures (16-20°C)

  • Optimizing codon usage for the expression host

The tag type should be determined during the production process based on preliminary expression tests to ensure optimal protein solubility and activity .

How can researchers design experiments to study the evolutionary rate variation in MT-CO2 across rodent lineages?

To effectively study evolutionary rate variation in MT-CO2 across rodent lineages, researchers should implement a comprehensive experimental design that accounts for both biological and analytical factors:

  • Sampling Strategy:

    • Include diverse representatives from major rodent lineages

    • Sample closely related species pairs from different lineages to enable relative rate tests

    • Include appropriate outgroups (non-rodent mammals)

    • Obtain multiple individuals per species to assess intraspecific variation

  • Sequencing Approach:

    • Sequence complete MT-CO2 gene rather than partial fragments

    • Consider whole mitochondrial genome sequencing for contextual analysis

    • Implement rigorous quality control to detect nuclear pseudogene amplification

    • Use consistent sequencing methods across all samples to minimize technical artifacts

  • Analytical Framework:

    • Implement relative rate tests to quantify lineage-specific rate differences

    • Use codon-based models to detect signatures of selection (dN/dS ratios)

    • Apply Bayesian relaxed clock methods to estimate branch-specific rates

    • Test for correlation between life history traits and evolutionary rates

  • Comparative Analysis:

    • Compare MT-CO2 evolution to other mitochondrial genes (especially COB)

    • Analyze nuclear gene markers in parallel for comparison

    • Investigate protein structural constraints through 3D modeling

    • Consider ecological and physiological factors that might influence selection pressure

This integrated approach can help disentangle the complex patterns of rate variation observed in MT-CO2 across rodent lineages and provide insights into the factors driving these differences .

What protocol modifications are necessary when using Perognathus flavus MT-CO2 in immunological assays compared to more common model species?

When using Perognathus flavus MT-CO2 in immunological assays, several protocol modifications are necessary compared to assays developed for common model species like mice (Mus musculus) or rats (Rattus norvegicus):

  • Antibody Selection and Validation:

    • Commercial antibodies may have limited cross-reactivity with Perognathus flavus proteins

    • Perform western blots to confirm antibody specificity against recombinant MT-CO2

    • Consider raising custom antibodies against species-specific epitopes

    • Use epitope mapping to identify conserved regions for cross-species detection

  • ELISA Optimization:

    • Determine optimal coating concentration (typically 1-5 μg/ml for recombinant proteins)

    • Test multiple blocking agents (BSA, milk, commercial blockers) for lowest background

    • Optimize antibody dilutions with checkerboard titration

    • Adjust incubation times and temperatures for maximum sensitivity

  • Sample Preparation:

    • Modify tissue lysis buffers to account for potential species differences in protein-lipid interactions

    • Adjust centrifugation speeds for mitochondrial isolation from Perognathus tissues

    • Consider native versus denaturing conditions based on epitope accessibility

  • Controls and Standards:

    • Include recombinant Perognathus flavus MT-CO2 as positive control

    • Use tissue samples from related species with known cross-reactivity as reference

    • Implement peptide competition assays to confirm antibody specificity

Researchers working with Peromyscus leucopus (white-footed mouse) have developed immunological protocols that may be adaptable to Perognathus flavus, given the phylogenetic relationship between these rodent species .

How does MT-CO2 compare to other mitochondrial markers for resolving phylogenetic relationships among closely related rodent species?

MT-CO2 has distinct characteristics compared to other mitochondrial markers when used for resolving phylogenetic relationships among closely related rodent species:

Mitochondrial MarkerEvolutionary RatePhylogenetic UtilityLimitations for Rodent Studies
MT-CO2ModerateGood for recent divergencesVariable performance across rodent lineages
Cytochrome bModerate-highWidely used standardSaturation at third positions
12S/16S rRNASlowGood for deeper relationshipsLimited resolution for recent divergences
Control regionFastHigh resolution for populationsHypervariable, alignment challenges
COIModerateDNA barcoding standardSimilar issues to cytochrome b

Research comparing MT-CO2 and cytochrome b (COB) genes in mammalian phylogeny has revealed that neither gene performs with consistently high accuracy across all taxonomic levels . MT-CO2 shows particular inconsistencies when analyzing relationships between rodent families, but may perform better for within-genus comparisons in some rodent groups.

Key considerations when using MT-CO2 for rodent phylogenetics include:

  • MT-CO2 shows lineage-specific evolutionary rates, requiring careful model selection

  • The gene performs inconsistently across different analytical methods (parsimony, neighbor joining)

  • Performance improves when combined with other markers in multi-gene analyses

  • Base composition bias can affect phylogenetic signal, particularly in highly divergent lineages

What insights can MT-CO2 sequence analysis provide about the evolutionary history of Perognathus flavus compared to other pocket mice?

MT-CO2 sequence analysis can provide several important insights into the evolutionary history of Perognathus flavus (Silky pocket mouse) in relation to other pocket mice species:

  • Divergence Dating: MT-CO2 molecular clock analyses can help estimate the timing of speciation events within the Perognathus genus, contextualizing their evolution within the broader geologic and climatic history of North America.

  • Biogeographic Patterns: Comparative analysis of MT-CO2 sequences across Perognathus species with different geographic distributions can reveal historical patterns of dispersal and vicariance, particularly in relation to the expansion and contraction of desert habitats.

  • Adaptive Evolution: Analysis of nonsynonymous to synonymous substitution ratios (dN/dS) in MT-CO2 can identify potential signatures of selection related to metabolic adaptations in different pocket mouse species, which may correlate with ecological specializations.

  • Population Structure: Within Perognathus flavus, MT-CO2 variation can reveal population structure and historical demographic changes, providing insights into how past climate fluctuations affected population sizes and connectivity.

  • Hybridization Detection: Discordance between MT-CO2 and nuclear markers may indicate historical hybridization events between Perognathus species, helping to identify instances of mitochondrial introgression.

The methodological approach should involve:

  • Comprehensive sampling across the geographic range of Perognathus flavus

  • Inclusion of multiple representatives from other Heteromyidae genera for comparative analysis

  • Integration of MT-CO2 data with other genetic markers and morphological data

  • Application of coalescent-based species tree methods to account for gene tree discordance

What are common pitfalls in recombinant MT-CO2 protein purification and how can they be addressed?

Purification of recombinant MT-CO2 presents several challenges due to its hydrophobic transmembrane domains and complex structural requirements. Common pitfalls and their solutions include:

  • Poor Solubility:

    • Problem: MT-CO2 may form inclusion bodies or aggregate during expression

    • Solution: Use solubility tags (MBP, SUMO); express at lower temperatures (16-20°C); include mild detergents (DDM, CHAPS) in lysis buffers; optimize buffer conditions with varying salt concentrations

  • Low Yield:

    • Problem: Membrane proteins often express at lower levels than soluble proteins

    • Solution: Scale up culture volume; optimize induction conditions; use specialized expression strains; consider codon optimization for the expression host

  • Protein Degradation:

    • Problem: MT-CO2 may be susceptible to proteolytic degradation

    • Solution: Include protease inhibitors in all buffers; work at 4°C; minimize purification time; add stabilizing agents like glycerol (already included in storage buffer)

  • Loss of Structural Integrity:

    • Problem: Recombinant MT-CO2 may not fold properly or may lose cofactors

    • Solution: Add copper ions during purification; purify under mild conditions; verify protein folding with circular dichroism or thermal shift assays

  • Tag Cleavage Issues:

    • Problem: Incomplete tag removal or protein precipitation after tag cleavage

    • Solution: Optimize protease digestion conditions; perform digestion while protein is bound to column; test different cleavage enzymes

A recommended purification workflow includes:

  • IMAC (immobilized metal affinity chromatography) as primary capture step

  • Size exclusion chromatography to remove aggregates and improve purity

  • Protein quality assessment by SDS-PAGE and western blotting

  • Functional verification through activity assays where possible

How can researchers address challenges in phylogenetic analysis when MT-CO2 and nuclear gene trees show conflicting topologies?

When MT-CO2 and nuclear gene trees yield conflicting topologies, researchers face significant interpretive challenges. These discordances may reflect biological processes or methodological artifacts that require systematic analytical approaches:

  • Distinguishing Biological from Methodological Discordance:

    • Test for long-branch attraction by varying taxonomic sampling

    • Implement model testing to ensure appropriate evolutionary models

    • Examine third codon position saturation that may affect MT-CO2 analyses

    • Apply likelihood mapping to assess phylogenetic signal strength

  • Addressing Biological Causes of Discordance:

    • Mitochondrial Introgression: Analyze geographic patterns of haplotype distribution; test for sex-biased dispersal signatures

    • Incomplete Lineage Sorting: Implement coalescent-based methods (ASTRAL, *BEAST); simulate expected gene tree distributions

    • Selection Pressure Differences: Compare dN/dS ratios between conflicting and congruent branches

    • Hybridization: Apply network-based approaches (PhyloNetworks, HyDe) to detect reticulate evolution

  • Methodological Approaches to Resolve Conflicts:

    • Concatenation with Partitioning: Model each gene separately while analyzing simultaneously

    • Species Tree Methods: Use gene tree summation methods that account for incomplete lineage sorting

    • Total Evidence Approach: Integrate morphological data with molecular data

    • Bayesian Concordance Analysis: Estimate primary concordance trees from multiple gene trees

  • Evaluating Confidence in Conflicting Signals:

    • Compare node support values between conflicting topologies

    • Implement approximately unbiased (AU) tests to evaluate alternative topologies

    • Use internode certainty metrics to quantify phylogenetic conflict

    • Examine the impact of different character weighting schemes on tree topology

Research has demonstrated that neither MT-CO2 nor cytochrome b performs with high consistency across all mammalian orders, suggesting that multiple genes and analytical approaches should be used in rodent phylogenetic studies .

What emerging technologies might enhance MT-CO2 research in non-model rodent species?

Several emerging technologies are poised to significantly advance MT-CO2 research in non-model rodent species like Perognathus flavus:

  • Long-read Sequencing Technologies:

    • PacBio and Oxford Nanopore sequencing enable complete mitochondrial genome assembly

    • Benefits include detection of structural variants and heteroplasmy in mitochondrial populations

    • Allows simultaneous analysis of MT-CO2 in genomic context with other mitochondrial genes

  • CRISPR/Cas9 Mitochondrial Editing:

    • Emerging mitochondrial genome editing techniques may allow functional studies

    • Base editors with mitochondrial targeting sequences can introduce specific mutations

    • Potential for creating cellular models with Perognathus flavus MT-CO2 variants

  • Single-cell Mitochondrial Analysis:

    • Single-cell sequencing can reveal tissue-specific mitochondrial heteroplasmy

    • Spatial transcriptomics may uncover tissue-specific MT-CO2 expression patterns

    • Offers insights into cell-type specific functions of MT-CO2

  • Cryo-EM for Structural Analysis:

    • Advanced cryo-electron microscopy enables high-resolution structural analysis of membrane proteins

    • Can reveal species-specific structural adaptations in cytochrome c oxidase complexes

    • Facilitates comparative structural biology among diverse rodent species

  • Proteomics Approaches:

    • High-sensitivity mass spectrometry can identify post-translational modifications

    • Crosslinking mass spectrometry reveals protein-protein interactions

    • Thermal proteome profiling can assess protein stability across conditions

  • Computational Approaches:

    • Machine learning algorithms for detecting selection signatures in MT-CO2 sequences

    • Molecular dynamics simulations to study functional implications of amino acid substitutions

    • Improved phylogenetic inference methods accounting for heterogeneous evolutionary processes

These technologies will enable researchers to move beyond sequence-based phylogenetics to functional studies of MT-CO2 in diverse rodent species, potentially revealing adaptive mechanisms related to metabolic requirements in different ecological niches.

How might MT-CO2 research contribute to our understanding of mitochondrial evolution in response to environmental adaptation?

MT-CO2 research in species like Perognathus flavus offers unique opportunities to understand mitochondrial evolution in response to environmental adaptation, particularly in the context of metabolic adjustments to challenging environments:

  • Altitudinal and Latitudinal Adaptations:

    • Comparative analysis of MT-CO2 sequences from populations across elevation gradients may reveal adaptive changes

    • Methodological approach: Sample Perognathus species from different elevations; sequence MT-CO2; correlate amino acid substitutions with oxygen availability; perform respiratory function assays

    • Expected outcomes: Identification of convergent substitutions in high-altitude populations; correlation between specific mutations and oxygen binding efficiency

  • Thermal Adaptation Mechanisms:

    • Pocket mice inhabit environments with extreme temperature fluctuations, potentially driving adaptive changes in mitochondrial function

    • Research approach: Compare MT-CO2 sequences from desert versus temperate populations; measure enzymatic activity at different temperatures; model protein stability across thermal ranges

    • Research question: Do desert-adapted pocket mice show MT-CO2 modifications that enhance efficiency at higher temperatures?

  • Metabolic Rate Evolution:

    • Small body size and high metabolic demands may influence selection pressure on MT-CO2

    • Experimental design: Correlate MT-CO2 sequence variation with metabolic rate measurements; examine evolutionary rate acceleration in lineages with changed metabolic requirements

    • Potential finding: Positive selection on specific MT-CO2 sites associated with metabolic rate changes

  • Mitonuclear Coevolution:

    • MT-CO2 interacts with nuclear-encoded subunits, requiring coordinated evolution

    • Research direction: Analyze patterns of coevolution between MT-CO2 and nuclear-encoded interaction partners; identify compensatory mutations

    • Significance: May reveal mechanisms maintaining functional integrity despite rapid mitochondrial evolution

  • Climate Change Response Prediction:

    • Historical MT-CO2 adaptation patterns may inform predictions about species' capacity to adapt to future climate change

    • Application: Develop models linking historical MT-CO2 evolution to environmental changes; predict adaptive potential based on standing genetic variation

The methodological approaches outlined above would significantly enhance our understanding of how mitochondrial genes like MT-CO2 contribute to environmental adaptation in rodents, with broader implications for mammalian evolution and conservation biology in the face of environmental change .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.