Recombinant Peromyscus gossypinus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ND3 Protein

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a mitochondrially encoded protein that functions as an essential component of Complex I (NADH:ubiquinone oxidoreductase) in the electron transport chain. This complex is responsible for the critical first step in cellular respiration, catalyzing electron transfer from NADH to ubiquinone while simultaneously pumping protons across the inner mitochondrial membrane. The gene encoding MT-ND3 is located in the mitochondrial DNA, reflecting its evolutionary significance and fundamental role in energy metabolism across eukaryotic species. In Peromyscus gossypinus, this protein maintains its conserved function while exhibiting species-specific sequence variations that make it valuable for comparative studies and targeted research applications.

The recombinant form of Peromyscus gossypinus MT-ND3 protein has been engineered with specific modifications to enhance its utility in laboratory settings, including the addition of an N-terminal histidine tag that facilitates purification and detection in experimental contexts. This recombinant version preserves the functional domains of the native protein while providing additional features that expand its research applications.

Comparative Sequence Analysis

When comparing the MT-ND3 sequence from Peromyscus gossypinus with related species, several notable patterns emerge, highlighting evolutionary conservation and species-specific adaptations. The table below presents a comparison between MT-ND3 sequences from different Peromyscus species:

SpeciesLength (aa)Key Sequence FeaturesUniProt ID
P. gossypinus (Cotton mouse)115MNMLMALMVNITLSILLITVAFWLPQLNMYT...Q95881
P. melanotis (Black-eared mouse)115MNMLMALLVNITLSTLLIIVAFWLPQLNLYT...Q95897
P. eremicus (Cactus mouse)PartialNot fully provided in sourcesO21604

Analysis of these sequences reveals high conservation at functional domains while exhibiting species-specific variations that may reflect evolutionary adaptations to different ecological niches. The Cotton mouse (P. gossypinus) MT-ND3 shows specific amino acid substitutions when compared to the Black-eared mouse (P. melanotis), particularly in positions affecting membrane interaction and protein folding .

Recombinant Protein Expression

The commercial recombinant Peromyscus gossypinus MT-ND3 protein is expressed in Escherichia coli expression systems, utilizing bacterial machinery to produce the mammalian protein in sufficient quantities for research applications . This heterologous expression approach overcomes the challenges associated with direct isolation from animal tissues, providing a sustainable and efficient source of the protein.

The recombinant protein is engineered with an N-terminal histidine tag (His-tag), which consists of multiple histidine residues that enable efficient purification through immobilized metal affinity chromatography (IMAC). This purification technique results in greater than 90% purity as determined by SDS-PAGE analysis, ensuring consistency and reliability in experimental applications .

Alternative Expression Systems

While E. coli remains the primary expression system for the Peromyscus gossypinus MT-ND3 protein referenced in most sources, related MT-ND3 proteins from other Peromyscus species can also be produced in yeast expression systems. The yeast-based expression may offer advantages for certain applications, particularly when eukaryotic post-translational modifications are desired .

Reconstitution Protocol

For optimal reconstitution of lyophilized recombinant MT-ND3 protein, the following procedure is recommended:

  1. Centrifuge the vial briefly before opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  4. Aliquot for long-term storage at -20°C/-80°C

This protocol minimizes protein denaturation and aggregation while ensuring consistent performance across experiments . The addition of glycerol serves as a cryoprotectant, preventing damage to the protein structure during freezing.

MT-ND3 in Complex I Function

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is an integral component of Complex I in the mitochondrial respiratory chain. This complex is responsible for the oxidation of NADH, reduction of ubiquinone, and the ejection of protons from the mitochondrial matrix, contributing to the proton gradient that drives ATP synthesis .

The specific role of MT-ND3 within Complex I includes:

  1. Participation in the membrane-embedded domain of Complex I

  2. Contribution to proton pumping across the inner mitochondrial membrane

  3. Maintenance of structural integrity within the multiprotein complex

  4. Facilitation of electron transfer through specific protein-protein interactions

These functions highlight the essential nature of MT-ND3 in cellular energy metabolism and explain its high conservation across mammalian species, including the Peromyscus genus .

Evolutionary Conservation

The MT-ND3 protein represents an interesting case of evolutionary conservation, as it is encoded by mitochondrial DNA rather than nuclear DNA. This mitochondrial encoding results in specific patterns of inheritance and evolution that differ from nuclear-encoded proteins. The conservation of sequence and function across different Peromyscus species, including P. gossypinus, P. melanotis, and P. eremicus, demonstrates the fundamental importance of this protein to cellular metabolism across evolutionary time .

Immunological Applications

The recombinant Peromyscus gossypinus MT-ND3 protein has significant applications in immunological research, including:

  1. Generation and validation of specific antibodies against MT-ND3

  2. Development of immunoassays for detecting MT-ND3 in biological samples

  3. Investigating species-specific immune responses

  4. Serving as control antigens in ELISA and other immunological techniques

These applications leverage the purified recombinant protein to enable specific detection and quantification of MT-ND3 in various experimental contexts.

Comparative Biology and Evolution Studies

The availability of recombinant MT-ND3 from Peromyscus gossypinus facilitates comparative studies with other species, allowing researchers to:

  1. Investigate evolutionary relationships within the Peromyscus genus

  2. Examine molecular adaptations to different ecological niches

  3. Study the co-evolution of mitochondrial and nuclear genomes

  4. Analyze species-specific variations in mitochondrial function

Such comparative approaches contribute to our understanding of evolutionary biology and the molecular basis of species adaptation .

Mitochondrial Disease Research

MT-ND3 proteins, including recombinant versions from model organisms like Peromyscus gossypinus, serve as valuable tools in mitochondrial disease research. Mutations in human MT-ND3 have been associated with mitochondrial disorders, making comparative studies with other mammalian MT-ND3 proteins important for understanding pathophysiology and developing potential therapeutic approaches .

Comparison with Other Peromyscus Species

The recombinant MT-ND3 proteins from different Peromyscus species exhibit high sequence similarity but with specific variations that reflect evolutionary divergence. The table below highlights key differences between MT-ND3 from Peromyscus gossypinus and related species:

FeatureP. gossypinus (Cotton mouse)P. melanotis (Black-eared mouse)M. senile (Sea anemone, for contrast)
Length115 amino acids115 amino acids118 amino acids
Starting sequenceMNMLMALM...MNMLMALL...MYTEFYGI...
Expression systemE. coliE. coliE. coli
UniProt IDQ95881Q95897Q35100

These differences, though subtle in some cases, may influence protein function, stability, and interactions with other components of the respiratory chain, potentially reflecting adaptations to different physiological demands .

Comparison with Human MT-ND3

The human version of MT-ND3 shares functional similarity with Peromyscus gossypinus MT-ND3 but exhibits sequence differences reflecting the evolutionary distance between these species. Human MT-ND3 is similarly involved in Complex I function but has specific sequence characteristics that make it distinct from rodent versions . The availability of recombinant versions of both human and Peromyscus MT-ND3 proteins enables comparative studies relevant to biomedical research.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specification.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Peromyscus gossypinus (Cotton mouse)
Target Names
Target Protein Sequence
MNMLMALMVNITLSILLITVAFWLPQLNMYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLYDLEIALLLPLPWAIQMYNTNTMMLTAFILVSVLALGLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in cellular metabolism?

MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) is a protein-coding gene that produces a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, also known as Complex I. This protein is essential for the catalytic activity of Complex I, which functions to catalyze electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor . As part of the mitochondrial electron transport chain, MT-ND3 plays a crucial role in cellular energy production through the process of oxidative phosphorylation. The protein contributes to the proton-pumping mechanism that generates the electrochemical gradient necessary for ATP synthesis, thereby supporting fundamental cellular metabolic processes .

How does recombinant MT-ND3 differ from the native protein?

The recombinant protein is typically supplied as a lyophilized powder in a storage buffer containing substances like Tris/PBS and trehalose (6%) at pH 8.0, which may differ from the native protein's physiological environment within the mitochondrial membrane . For experimental purposes, researchers should consider these differences when interpreting results obtained with recombinant proteins.

What are the optimal conditions for reconstitution and storage of recombinant MT-ND3 protein?

For optimal reconstitution of lyophilized recombinant MT-ND3 protein, researchers should:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage

For working solutions, aliquots can be stored at 4°C for up to one week. Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity and activity . For experimental reproducibility, it's critical to maintain consistent reconstitution and storage protocols across studies.

What techniques are most effective for measuring MT-ND3 activity in experimental settings?

Several methodological approaches can be employed to assess MT-ND3 functionality as part of Complex I:

  • ATP Production Assay: This measures mitochondrial ATP synthesis capacity using substrate combinations specific to Complex I (glutamate + malate or pyruvate + malate). The method involves:

    • Preparation of cells or isolated mitochondria in appropriate buffers

    • Addition of ATP monitoring reagent, ADP, and specific substrates

    • Measurement of light emission over time using a plate reader

    • Comparison of ATP production rates with and without oligomycin to determine specific mitochondrial ATP synthesis

  • Respiratory Chain Complex I Activity Measurement: Direct measurement of NADH:ubiquinone oxidoreductase activity using spectrophotometric methods.

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique allows for analysis of intact respiratory chain complexes and can reveal assembly defects or reduced levels of Complex I containing MT-ND3 .

It's important to incorporate appropriate controls, including measurement with Complex I inhibitors (like rotenone) to confirm specificity of the observed activity to MT-ND3 function.

How can researchers effectively analyze MT-ND3 mutations in experimental models?

Analysis of MT-ND3 mutations requires a multi-faceted approach:

  • DNA Sequencing Methods:

    • Sanger sequencing of mtDNA for known or suspected mutations

    • Whole-genome sequencing (WGS) for comprehensive genetic analysis

    • Last-cycle hot PCR for quantification of heteroplasmy levels in different tissues

  • Tissue Selection Considerations:

    • MT-ND3 mutations may show varying heteroplasmy levels across different tissues

    • Muscle tissue often shows higher mutation loads than blood or cultured cells

    • Multiple tissue types should be examined when possible to assess mutation distribution

  • Functional Validation:

    • Measurement of Complex I activity in patient-derived samples

    • ATP production assays with different substrate combinations

    • Morphological examination of tissues (e.g., muscle) for mitochondrial abnormalities

    • In silico analyses to predict the impact of specific amino acid substitutions

Researchers should note that culture conditions may lead to selection against pathogenic MT-ND3 mutations, as observed in the case of myoblast cultures that showed normal respiratory chain activity despite the presence of mutations in the original muscle tissue .

How should heteroplasmy be addressed in MT-ND3 research designs?

Heteroplasmy (the presence of both normal and mutant mtDNA within cells) represents a critical variable in MT-ND3 research that requires specific experimental approaches:

  • Quantification Methods:

    • Last-cycle hot PCR is an effective method for accurate quantification of heteroplasmy levels

    • Next-generation sequencing approaches can provide deep coverage of heteroplasmic variants

    • Results should be validated across multiple methodologies when possible

  • Tissue-Specific Considerations:

    • Experimental designs must account for tissue-specific differences in heteroplasmy levels

    • As demonstrated in clinical studies, mutations like m.10372A>G in MT-ND3 may show high heteroplasmy in muscle tissue but be undetectable in blood or cultured cells

    • A comprehensive tissue sampling strategy is recommended for accurate assessment

  • Threshold Effect Analysis:

    • Studies should be designed to determine the threshold of heteroplasmy required for biochemical and clinical manifestations

    • Include samples with varying heteroplasmy levels to establish dose-response relationships

    • Control for mitochondrial DNA copy number variations that may affect phenotypic expression

The table below illustrates typical heteroplasmy patterns observed across different tissue types for MT-ND3 mutations:

Tissue TypeTypical Heteroplasmy RangeConsiderations for Experimental Design
Skeletal Muscle70-95%Often highest levels; preferred for initial detection
Blood0-30%May show low or undetectable levels despite clinical symptoms
Cultured Fibroblasts0-50%Selection against mutation may occur in culture
Cultured Myoblasts0-20%Significant selection against mutation in culture
Urinary Epithelial Cells10-70%Non-invasive source with variable heteroplasmy

What are the most important controls to include in experiments involving recombinant MT-ND3?

Robust experimental design for recombinant MT-ND3 studies requires several key controls:

  • Protein Quality Controls:

    • SDS-PAGE analysis to confirm protein purity (>90% is standard for recombinant preparations)

    • Western blot verification of His-tag (or other fusion tags) presence and integrity

    • Mass spectrometry validation of full-length protein sequence

  • Functional Assay Controls:

    • Inclusion of known Complex I inhibitors (e.g., rotenone) as negative controls

    • Parallel testing of wild-type and mutant forms of the protein

    • Substrate specificity controls (e.g., testing Complex II substrates like succinate)

    • Comparison of activity with and without oligomycin to distinguish ATP synthase-dependent effects

  • System-Specific Controls:

    • For cell-based assays: mock-transfected/empty vector controls

    • For in vitro reconstitution studies: buffer-only and denatured protein controls

    • For tissue studies: age-matched and tissue-matched control samples

Implementation of these controls helps distinguish specific MT-ND3 effects from experimental artifacts and provides necessary validation for research findings.

How can researchers address the challenge of distinguishing primary MT-ND3 effects from secondary mitochondrial dysfunction?

Distinguishing primary MT-ND3 dysfunction from secondary mitochondrial abnormalities requires systematic experimental approaches:

  • Sequential Respiratory Chain Complex Analysis:

    • Measure activities of all respiratory chain complexes (I-V)

    • MT-ND3 mutations typically cause isolated Complex I deficiency without affecting other complexes

    • Ratios of Complex I to other complexes provide normalized data that controls for mitochondrial content

  • Genetic Complementation Studies:

    • Expression of wild-type MT-ND3 in affected cells/models to demonstrate rescue of phenotype

    • Use of cybrid technology (transferring mitochondria to mtDNA-depleted cells) to isolate mitochondrial genetic effects

  • Time-Course Experiments:

    • Early vs. late changes in cellular phenotypes following induced MT-ND3 dysfunction

    • Monitoring of retrograde signaling pathways that represent secondary adaptive responses

    • Assessment of mitochondrial network morphology changes over time

  • Targeted Metabolomic Analysis:

    • Profiling of TCA cycle intermediates

    • Measurement of NAD+/NADH ratios

    • Analysis of amino acid metabolism changes that may indicate compensatory mechanisms

These approaches collectively provide a framework for determining the direct consequences of MT-ND3 dysfunction versus downstream cellular adaptations.

What disease models are most appropriate for studying MT-ND3-related pathologies?

MT-ND3 mutations are associated with several clinical conditions, including Leigh syndrome, MELAS (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes), and sensorimotor axonal polyneuropathy . Appropriate disease models include:

  • Patient-Derived Models:

    • Primary fibroblasts from patients with confirmed MT-ND3 mutations

    • Induced pluripotent stem cells (iPSCs) differentiated into affected cell types (neurons, myocytes)

    • Tissue samples from affected individuals (muscle biopsies)

  • Engineered Cellular Models:

    • Cybrid cell lines containing patient mtDNA in a controlled nuclear background

    • CRISPR/Cas9-engineered mtDNA mutations (with limitations due to mitochondrial genome editing challenges)

  • Animal Models:

    • Species-specific considerations are important, as the Cotton mouse (Peromyscus gossypinus) MT-ND3 has structural similarities but also differences compared to human MT-ND3

    • Mitochondrial mutator mouse models with general mtDNA instability

    • Conditional knockout models affecting Complex I assembly or function

The choice of model should be guided by the specific research question, with consideration of tissue-specific pathology and heteroplasmy levels observed in the clinical condition of interest.

How can research on recombinant MT-ND3 contribute to therapeutic development for mitochondrial diseases?

Research on recombinant MT-ND3 can advance therapeutic strategies through several avenues:

  • Drug Screening Platforms:

    • Recombinant MT-ND3 can be used to develop high-throughput screens for compounds that stabilize mutant protein function

    • In vitro assays using purified recombinant protein to test direct interactions with therapeutic candidates

  • Structure-Function Relationship Studies:

    • Detailed mapping of functional domains through site-directed mutagenesis

    • Identification of critical residues that could be targets for therapeutic intervention

    • Understanding of how specific mutations (like m.10372A>G) affect protein function and Complex I assembly

  • Development of Protein Replacement Approaches:

    • Engineering of modified recombinant MT-ND3 with enhanced mitochondrial targeting and membrane integration

    • Exploration of mitochondrial protein import pathways for therapeutic delivery

    • Assessment of allotopic expression strategies (nuclear expression of mitochondrial genes)

  • Biomarker Identification:

    • Correlation of specific MT-ND3 variants with clinical phenotypes

    • Development of assays to measure MT-ND3 function as outcome measures for clinical trials

    • Identification of surrogate markers that reflect MT-ND3 dysfunction in accessible tissues

These research directions collectively support the translation of basic MT-ND3 biology into potential therapeutic applications for mitochondrial disorders.

What are the future research directions for Peromyscus gossypinus MT-ND3?

Future research involving Peromyscus gossypinus MT-ND3 will likely focus on:

  • Comparative Mitochondrial Genomics:

    • Detailed comparison of MT-ND3 structure and function across species, with particular attention to differences between Peromyscus gossypinus and human MT-ND3

    • Evolutionary analysis to identify conserved domains critical for function

    • Investigation of species-specific adaptations in mitochondrial energy metabolism

  • Advanced Structural Biology:

    • Cryo-EM studies of Complex I containing Peromyscus gossypinus MT-ND3

    • Molecular dynamics simulations to understand protein-membrane interactions

    • Structural basis for species differences in susceptibility to mitochondrial toxins

  • Systems Biology Approaches:

    • Integration of MT-ND3 into broader mitochondrial interaction networks

    • Multi-omics studies to understand the impact of MT-ND3 variations on metabolic pathways

    • Mathematical modeling of Complex I function with different MT-ND3 variants

  • Methodological Innovations:

    • Development of more sensitive assays for detecting low levels of heteroplasmy

    • Non-invasive biomarkers reflecting MT-ND3 function for clinical applications

    • Improved recombinant expression systems for mitochondrial membrane proteins

These research directions will contribute to our fundamental understanding of mitochondrial biology and potentially lead to novel diagnostic and therapeutic approaches for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.