Recombinant Peromyscus maniculatus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate your desired format when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your own formulations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag for your product.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Peromyscus maniculatus (North American deer mouse)
Target Names
Target Protein Sequence
MNMLTALLVNITLSMLLIIVAFWLPQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMYNIDIMMLTAFILVSVLALGLAYEWLQKGLEWTE
Uniprot No.

Target Background

Function
Recombinant Peromyscus maniculatus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This protein is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its significance in mitochondrial function?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a critical component of mitochondrial Complex I, which serves as the initial enzyme in the electron transport chain of oxidative phosphorylation. As one of seven mitochondrially-encoded subunits of Complex I, MT-ND3 plays a vital role in cellular energy production through the transfer of electrons from NADH to ubiquinone . The protein contains a conserved loop structure that mediates the active/deactive state transition of Complex I, making it essential for regulating respiratory chain function . In Peromyscus maniculatus (deer mouse), MT-ND3 has gained particular research interest due to this species' adaptability to diverse environments and its utility as a model organism for evolutionary and comparative mitochondrial studies .

How does recombinant MT-ND3 differ from native MT-ND3?

Recombinant MT-ND3 is typically produced in expression systems such as E. coli with added tags (e.g., His-tag) to facilitate purification . While the core amino acid sequence remains the same, several important differences exist:

  • Post-translational modifications: Native MT-ND3 undergoes specific mitochondrial post-translational modifications that may be absent in recombinant versions expressed in bacteria.

  • Protein folding: The recombinant protein may exhibit subtle differences in tertiary structure due to different folding environments between bacterial cytoplasm and mitochondrial matrix.

  • Functional integration: Recombinant MT-ND3 is produced in isolation, whereas native MT-ND3 is synthesized within the mitochondria and co-assembled with other Complex I subunits.

  • Stability characteristics: Recombinant versions often require special storage conditions (lyophilized or in buffer with additives like 6% trehalose) to maintain stability, while native protein exists in the lipid environment of the inner mitochondrial membrane .

These differences should be considered when designing experiments using recombinant MT-ND3 proteins for structural studies or antibody production.

What are the optimal expression and purification methods for recombinant Peromyscus maniculatus MT-ND3?

Successful expression and purification of recombinant MT-ND3 requires specific methodological considerations due to its hydrophobic nature as a membrane protein. Based on protocols established for related species:

Expression System:

  • E. coli is the preferred expression host for MT-ND3, providing high yields and cost-effectiveness .

  • BL21(DE3) or C41(DE3) strains are recommended for membrane protein expression.

  • Expression vectors containing T7 promoters with N-terminal His-tags facilitate detection and purification.

Expression Conditions:

  • Induction with 0.5-1.0 mM IPTG at lower temperatures (16-20°C) for 16-18 hours yields better results than standard conditions.

  • Supplementing the medium with rare codons may improve expression levels.

Purification Protocol:

  • Cell lysis using mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) rather than harsh sonication.

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradient elution.

  • Size exclusion chromatography as a polishing step.

  • Final formulation in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

Protein purity should exceed 90% as verified by SDS-PAGE, with expected yield between 1-5 mg per liter of culture. Storage recommendations include lyophilization or aliquoting with 50% glycerol for long-term storage at -80°C, avoiding repeated freeze-thaw cycles .

What techniques are used for detecting MT-ND3 mutations and polymorphisms in Peromyscus maniculatus?

Several molecular techniques have been developed for detecting mutations and polymorphisms in the MT-ND3 gene:

PCR Amplification and Sanger Sequencing:

  • Standard approach using specific primers flanking the MT-ND3 gene region.

  • Primers reported in literature: Forward 5′-CCACAACTCAACGGCTACAT-3′, Reverse 5′-TGGGTGTTGAGGGTTATGAG-3′, generating a 491 bp product .

  • Sequencing is performed using BigDye Terminator chemistry on automated sequencers.

Next-Generation Sequencing (NGS):

  • Whole mitochondrial genome sequencing provides comprehensive coverage of MT-ND3 and surrounding regions.

  • Targeted mitochondrial DNA enrichment prior to NGS improves detection sensitivity.

SNP Detection Methods:

  • High-resolution melt (HRM) analysis for rapid screening.

  • Restriction fragment length polymorphism (RFLP) analysis for known mutation sites.

  • Allele-specific PCR for specific polymorphisms.

Base Editing Detection:

  • For experimental modifications using techniques like DddA-derived cytosine base editors (DdCBE), detection typically involves PCR amplification followed by Sanger sequencing or next-generation sequencing .

  • Editing efficiency is calculated by analyzing chromatogram peak heights or NGS read counts.

These methods have been effectively used to identify polymorphisms such as those at positions m.9576 G and m.9577 G in mouse MT-ND3, which correspond to similar regions in Peromyscus species .

How can researchers apply mitochondrial base editing techniques to study MT-ND3 function?

Mitochondrial base editing represents a cutting-edge approach for investigating MT-ND3 function through precise genetic modifications. The methodology involves:

DddA-derived cytosine base editor (DdCBE) System:

  • This technique enables C-to-T conversions in mitochondrial DNA without requiring double-strand breaks.

  • For MT-ND3 studies, researchers can design paired TALE domains binding to mtDNA light (L) and heavy (H) strands flanking the target region .

  • DdCBE splits (G1333 or G1397) are fused to these TALE domains to target specific cytosine residues.

Experimental Design Process:

  • Target Selection: Identify conserved functional regions, such as the ND3 loop involved in active/deactive state transition of Complex I .

  • TALE Design: Create custom TALE domains (typically 15-16 bp binding sites) that flank the target sequence.

  • Vector Construction: Clone the DdCBE components into appropriate expression vectors, typically including fluorescent markers for transfection monitoring.

  • Delivery Method: For in vitro studies, transfect cultured cells and sort using FACS at 24h post-transfection. For in vivo applications, package the system into AAV vectors for tissue-specific delivery .

  • Validation: Confirm editing via Sanger sequencing and functional assays after 6-7 days post-transfection.

Research Applications:

  • Creating precise point mutations that mimic naturally occurring polymorphisms.

  • Introducing premature stop codons (e.g., G40* in MT-ND3) to study truncated protein effects .

  • Investigating structure-function relationships in conserved domains.

  • Developing disease models by introducing pathogenic mutations.

This approach has been successfully used to edit mouse MT-ND3 at positions m.9576 G and m.9577 G and could be adapted for Peromyscus maniculatus MT-ND3 studies with appropriate sequence modifications .

How is recombinant MT-ND3 used in antibody production and immunological studies?

Recombinant MT-ND3 serves as a valuable antigen for producing antibodies and conducting immunological research:

Antibody Production Protocol:

  • Immunization: Purified recombinant MT-ND3 protein (>90% purity) is used to immunize rabbits or mice, typically at 250-500 μg per animal with complete Freund's adjuvant, followed by boosters with incomplete adjuvant.

  • Antibody Purification: Serum is collected and antibodies are purified using protein A/G affinity chromatography or antigen-specific affinity purification.

  • Validation: Antibodies are validated using Western blotting, immunoprecipitation, and immunohistochemistry against both recombinant protein and native mitochondrial extracts.

Research Applications:

  • Western Blotting: Detection of MT-ND3 expression levels in different tissues or under various experimental conditions.

  • Immunoprecipitation: Studying protein-protein interactions within Complex I.

  • Immunohistochemistry/Immunofluorescence: Examining tissue-specific distribution of MT-ND3.

  • Flow Cytometry: Quantifying mitochondrial content in cells when used with permeabilization techniques.

Technical Considerations:

  • The hydrophobic nature of MT-ND3 can limit epitope accessibility, so antibodies raised against specific regions (particularly hydrophilic loops) often perform better.

  • Cross-reactivity validation between Peromyscus maniculatus MT-ND3 and other species should be performed when using these antibodies in comparative studies .

  • Controls using pre-immune serum and competing peptides are essential for confirming specificity.

These antibodies enable researchers to track MT-ND3 expression, localization, and modifications in various experimental contexts, furthering our understanding of mitochondrial biology.

What are the approaches for functional characterization of MT-ND3 variants in Peromyscus maniculatus?

Functional characterization of MT-ND3 variants requires integrated approaches combining genetic, biochemical, and physiological methods:

Cellular Respiration Analysis:

Structural and Assembly Analysis:

  • Blue Native PAGE: To examine if variants affect the assembly of Complex I.

  • Proteomic Analysis: Mass spectrometry to identify altered protein-protein interactions within the respiratory chain.

  • Cryo-EM: For detailed structural analysis of purified Complex I containing variant MT-ND3.

Genetic Approaches:

  • Cybrid Cell Models: Transfer of mitochondria containing MT-ND3 variants into ρ⁰ cells (lacking mtDNA) for controlled background studies.

  • Base Editing: Introduction of specific mutations using DdCBE technology to create isogenic cell lines differing only in MT-ND3 sequence .

  • Animal Models: Generation of mice or cell lines expressing Peromyscus MT-ND3 variants using mitochondrial base editing techniques.

Physiological Impact Assessment:

  • Growth Curves and Viability Assays: To determine if variants affect cellular fitness.

  • Metabolic Flux Analysis: Using isotope tracers to track changes in metabolic pathways.

  • Adaptation Studies: Examining how MT-ND3 variants may contribute to adaptation to different environmental conditions, particularly relevant for Peromyscus species known for environmental adaptability .

This multi-layered approach allows for comprehensive characterization of how specific variations in MT-ND3 sequence impact mitochondrial function and cellular physiology.

How can MT-ND3 be used as a marker for evolutionary studies in Peromyscus species?

MT-ND3 has emerged as a valuable marker for evolutionary and phylogenetic studies in Peromyscus and related rodent species:

Phylogenetic Analysis Methodology:

  • Sequence Acquisition: PCR amplification and sequencing of MT-ND3 from multiple Peromyscus populations and related species.

  • Sequence Alignment: Multiple sequence alignment using programs like MUSCLE or CLUSTAL.

  • Phylogenetic Tree Construction: Using methods such as Bayesian inference, maximum likelihood, and parsimony analysis to determine evolutionary relationships .

  • Divergence Time Estimation: Molecular clock analyses to estimate when different lineages diverged.

Applications in Peromyscus Research:

  • Species Delineation: MT-ND3 sequence data has contributed to evidence for multiple species within what was previously classified as Peromyscus maniculatus, helping to resolve the taxonomy of this diverse group .

  • Population Genetics: Analysis of polymorphisms to examine population structure and gene flow between groups.

  • Adaptive Evolution: Identification of signatures of selection in MT-ND3 sequences that may reflect adaptation to different ecological niches.

  • Biogeographic Studies: Using MT-ND3 sequence variation to track historical migration patterns and population expansions.

Comparative Data:
Analysis of MT-ND3 sequences has revealed distinct clades within the Peromyscus complex, including:

  • P. maniculatus (Clade K, cf P. maniculatus)

  • P. maniculatus (Clade L, cf P. labecula)

  • P. maniculatus (Clade I, cf P. sonoriensis)

  • P. gambelii (Clade E)

  • P. sejugis (Clade E)

  • P. keeni (Clade Fa)

  • P. melanotis (Clade A)

These findings demonstrate that MT-ND3, along with other mitochondrial markers, provides critical information for understanding the complex evolutionary history and speciation processes within Peromyscus, highlighting its utility beyond functional studies.

What is known about the association between MT-ND3 polymorphisms and disease susceptibility?

MT-ND3 polymorphisms have been linked to several human diseases, providing valuable comparative insights for Peromyscus studies:

Gastric Cancer Association:

  • Multiple SNPs in MT-ND3 have been associated with increased gastric cancer risk, including rs28358278, rs2853826, and rs41467651.

  • The rs2853826 polymorphism showed significant association with gastric cancer development across multiple clinical parameters (adjusted OR = 2.00, 95% CI = 1.12-3.55, P = 0.019 in lymph node metastasis negative subjects; adjusted OR = 2.10, 95% CI = 1.05-4.22, P = 0.037 in lymph node metastasis positive subjects) .

  • These associations were consistent across different tumor stages and classifications, suggesting a fundamental role in cancer development .

Other Disease Associations:

  • MT-ND3 polymorphisms have been linked to:

    • Parkinson's disease

    • Type 2 diabetes mellitus (with rs2853826 associated with increased ROS production)

    • Breast cancer

    • Esophageal cancer

  • Mutations in MT-ND3 have been identified in patients with Leigh syndrome, a severe neurological disorder .

Mechanistic Insights:

  • The primary mechanism appears to involve altered ROS production, which can damage cellular components and initiate disease processes.

  • Some polymorphisms affect the conserved ND3 loop involved in active/deactive state transition of Complex I, potentially altering energy production efficiency and cellular metabolism .

  • The resulting mitochondrial dysfunction may contribute to various pathological processes including neurodegeneration, metabolic disorders, and cancer progression.

These findings highlight the critical role of MT-ND3 in maintaining cellular homeostasis and suggest that comparative studies in Peromyscus models could provide valuable insights into disease mechanisms and potential therapeutic approaches.

How can MT-ND3 research in Peromyscus contribute to understanding human mitochondrial disorders?

Peromyscus maniculatus MT-ND3 research offers unique advantages for modeling and understanding human mitochondrial disorders:

Comparative Genomic Insights:

  • Peromyscus species show varying degrees of sequence conservation with human MT-ND3, particularly in functionally critical regions.

  • Studies of natural variants in Peromyscus can identify which regions of MT-ND3 are under evolutionary constraint, suggesting functional importance.

  • The diversity within Peromyscus species provides a natural laboratory for understanding how different MT-ND3 variants function in different genetic backgrounds .

Disease Modeling Approaches:

  • Environmental Adaptation Models: Peromyscus species have adapted to diverse environments, making them excellent models for studying how MT-ND3 variations contribute to metabolic adaptation under different stressors.

  • Base Editing Applications: Techniques like DdCBE can introduce specific human disease-associated mutations into Peromyscus MT-ND3 to create relevant disease models .

  • Cybrid Models: Creating cybrid cells containing Peromyscus MT-ND3 variants in human nuclear backgrounds to study mitochondrial-nuclear interactions.

Translational Research Pathways:

  • Drug Screening: Peromyscus models with disease-relevant MT-ND3 mutations can be used to screen potential therapeutic compounds.

  • Bioenergetic Interventions: Testing metabolic interventions that may bypass or compensate for MT-ND3 dysfunction.

  • Gene Therapy Development: Testing mitochondrial gene editing approaches in Peromyscus models before human applications.

Advantages Over Traditional Models:

  • Peromyscus offers greater genetic diversity than inbred laboratory mice.

  • Their longer lifespan allows better modeling of age-related mitochondrial dysfunction.

  • Natural variants provide insights into compensatory mechanisms that may not be apparent in artificial models.

This research bridge between evolutionary biology and clinical medicine makes Peromyscus MT-ND3 studies particularly valuable for translating basic science findings into potential therapeutic approaches for human mitochondrial disorders.

What methodologies exist for studying MT-ND3 interactions with environmental stressors?

Investigating how MT-ND3 responds to and mediates the effects of environmental stressors involves specialized experimental approaches:

Cellular and Molecular Methods:

  • Hypoxia Exposure Protocols:

    • Exposing cells or animals to defined oxygen concentrations (1-5% O₂) for varying durations.

    • Monitoring MT-ND3 expression, modification, and Complex I activity changes.

    • Comparing responses between different Peromyscus populations adapted to different altitudes.

  • Temperature Challenge Experiments:

    • Acute or chronic temperature stress models (4°C to 37°C).

    • Analysis of MT-ND3 thermal stability and Complex I function across temperature gradients.

    • Comparing cold-adapted and warm-adapted Peromyscus populations.

  • Oxidative Stress Induction:

    • Treatment with agents like paraquat, H₂O₂, or rotenone.

    • Measurement of MT-ND3 oxidative modifications using mass spectrometry.

    • ROS production quantification using fluorescent probes.

Biochemical Assessment Methods:

  • Enzyme Kinetics Analysis: Measuring Complex I activity across varying substrate concentrations and environmental conditions.

  • Protein-Protein Interaction Studies: Using co-immunoprecipitation or proximity ligation assays to examine how stressors affect MT-ND3 interactions with other proteins.

  • Post-translational Modification Analysis: Mass spectrometry to identify stress-induced modifications of MT-ND3.

In Vivo Approaches:

  • Altitude Adaptation Studies: Comparing MT-ND3 sequence and function between lowland and highland Peromyscus populations.

  • Exercise Challenge Models: Examining how acute and chronic exercise affects MT-ND3 function.

  • Dietary Stress Models: Investigating how caloric restriction or high-fat diets impact MT-ND3 and mitochondrial function.

Data Analysis Frameworks:

  • Systems Biology Approaches: Integrating transcriptomic, proteomic, and metabolomic data to create comprehensive models of MT-ND3 response to stressors.

  • Statistical Methods: Multivariate analysis to correlate environmental parameters with MT-ND3 sequence variations and functional outcomes.

  • Population Genetics Analysis: Examining selective pressures on MT-ND3 in different environments.

These methodologies enable researchers to understand how MT-ND3 variants contribute to environmental adaptation and stress resistance, with potential applications in both evolutionary biology and biomedical research.

What are the emerging technologies that could advance MT-ND3 research in Peromyscus models?

Several cutting-edge technologies are poised to revolutionize MT-ND3 research in Peromyscus models:

Advanced Genetic Engineering Tools:

  • Mitochondrial Base Editors: Further refinement of DdCBE technology for more precise and efficient editing of MT-ND3 .

  • CRISPR-free Approaches: Development of alternative editing tools specifically designed for mitochondrial genomes.

  • AAV-mediated Delivery Systems: Optimization of adeno-associated viral vectors for tissue-specific delivery of mitochondrial editing tools in Peromyscus models .

Advanced Imaging Technologies:

  • Super-resolution Microscopy: Techniques like STORM and PALM to visualize MT-ND3 within the mitochondrial membrane at nanometer resolution.

  • Cryo-Electron Tomography: For in situ structural analysis of MT-ND3 within intact mitochondria.

  • Live-cell Imaging: Development of specific probes and tags compatible with MT-ND3 for real-time monitoring of its dynamics.

Single-Cell and Single-Molecule Technologies:

  • Single-cell Mitochondrial Genomics: For analyzing heteroplasmy and MT-ND3 variants at the individual cell level.

  • Patch-clamp Techniques: Adapted for studying the electrophysiological properties of Complex I containing different MT-ND3 variants.

  • Single-molecule FRET: For studying conformational changes in MT-ND3 during Complex I activity.

Computational and Systems Biology Approaches:

  • Machine Learning Algorithms: For predicting the functional impact of MT-ND3 mutations.

  • Molecular Dynamics Simulations: To model how sequence variations affect MT-ND3 structure and function.

  • Multi-omics Integration: Combining genomics, proteomics, and metabolomics data to create comprehensive models of MT-ND3 function.

Translational Research Platforms:

  • Organoid Models: Development of Peromyscus-derived organoids for tissue-specific studies of MT-ND3 function.

  • In Vivo Monitoring Systems: Non-invasive methods to track mitochondrial function in living animals.

  • High-throughput Drug Screening Platforms: For identifying compounds that modulate MT-ND3 function or compensate for dysfunction.

These emerging technologies promise to provide unprecedented insights into MT-ND3 biology, from molecular interactions to whole-organism physiology, accelerating both basic science discoveries and translational applications.

What are the current challenges in MT-ND3 research and potential solutions?

MT-ND3 research faces several significant challenges that require innovative solutions:

Technical Challenges:

  • Mitochondrial Genome Editing Limitations:

    • Challenge: Difficulty in precisely editing mitochondrial DNA compared to nuclear DNA.

    • Solution: Continued refinement of base editors like DdCBE specifically designed for mitochondrial targets, with improved specificity and efficiency .

  • Protein Expression and Purification Issues:

    • Challenge: MT-ND3 is hydrophobic and difficult to express as a functional recombinant protein.

    • Solution: Development of specialized membrane protein expression systems with optimized detergents and lipid environments .

  • Heteroplasmy Quantification:

    • Challenge: Accurately measuring the proportion of mutant versus wild-type MT-ND3 in tissues.

    • Solution: Digital droplet PCR and next-generation sequencing approaches with improved sensitivity for low-level heteroplasmy detection.

Biological Complexity Challenges:

  • Mitochondrial-Nuclear Crosstalk:

    • Challenge: Understanding how MT-ND3 variants interact with nuclear-encoded proteins.

    • Solution: Systematic analysis using cybrid cells with controlled nuclear backgrounds and various MT-ND3 variants.

  • Tissue-Specific Effects:

    • Challenge: MT-ND3 mutations may affect tissues differently depending on their metabolic demands.

    • Solution: Development of tissue-specific in vivo models using AAV-delivered mitochondrial base editors .

  • Environmental Interactions:

    • Challenge: Environmental factors can modify the phenotypic expression of MT-ND3 variants.

    • Solution: Controlled environmental exposure studies comparing different Peromyscus populations.

Research Infrastructure Challenges:

  • Limited Peromyscus Genetic Resources:

    • Challenge: Fewer genetic tools available compared to traditional mouse models.

    • Solution: Development of Peromyscus-specific genetic resources, including reference genomes, transcriptomes, and breeding colonies.

  • Standardization Issues:

    • Challenge: Variation in experimental protocols makes cross-study comparisons difficult.

    • Solution: Establishment of standardized protocols for MT-ND3 analysis and reporting guidelines.

  • Interdisciplinary Gaps:

    • Challenge: Disconnect between evolutionary biologists, mitochondrial researchers, and clinical scientists.

    • Solution: Creation of collaborative networks and conferences specifically focused on translational mitochondrial research in non-traditional models.

Addressing these challenges requires coordinated efforts across disciplines, combining expertise in molecular biology, genetics, biochemistry, evolutionary biology, and clinical research to advance our understanding of MT-ND3 biology and its implications for health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.