Recombinant Peromyscus melanotis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. For accurate delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months under the same storage conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While we strive to select appropriate tags during production, we are open to fulfilling specific tag type requests. Please inform us of your preference and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Peromyscus melanotis (Black-eared mouse)
Target Names
Target Protein Sequence
MNMLMALLVNITLSTLLIIVAFWLPQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMYNINIMMLTAFILVSVLALGLAYEWVQKGLEWTE
Uniprot No.

Target Background

Function
Recombinant Peromyscus melanotis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. MT-ND3 plays a crucial role in the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in mitochondrial biology?

MT-ND3 (mitochondrial NADH-ubiquinone oxidoreductase chain 3) is a critical component of Complex I in the mitochondrial respiratory chain. As part of the NADH dehydrogenase complex, it facilitates electron transfer from NADH to ubiquinone during oxidative phosphorylation. The protein contains 115 amino acids in Peromyscus species and is encoded by the mitochondrial genome .

MT-ND3 plays a crucial role in the active/deactive state transition of Complex I, particularly through its conserved loop regions . This function is essential for regulating energy production and may have implications for cellular response to oxidative stress. Research methodologies involving purified recombinant MT-ND3 enable detailed structural and functional studies of this protein in isolation from the complete Complex I.

How do expression systems affect the quality of recombinant MT-ND3 production?

For optimal expression of recombinant MT-ND3, E. coli serves as the predominant expression system as evidenced in multiple studies . When designing expression experiments, researchers should consider:

  • Codon optimization for the host organism

  • Selection of appropriate fusion tags (typically N-terminal His tags)

  • Expression conditions to minimize inclusion body formation

  • Extraction protocols that preserve protein structure

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis . For consistent results, expression in E. coli followed by affinity chromatography using the His tag provides reproducible protein quality across different Peromyscus species MT-ND3 variants.

What are the optimal storage and handling protocols for recombinant MT-ND3?

Recombinant MT-ND3 requires specific handling protocols to maintain its structural integrity and functional properties:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid freeze-thaw cycles
Working storage4°CFor up to one week
Storage bufferTris/PBS-based, 6% Trehalose, pH 8.0Maintains protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation recommended before opening
Cryoprotectant5-50% glycerol (final concentration)50% glycerol is standard practice

Repeated freeze-thaw cycles significantly impact protein stability and should be avoided . For long-term storage applications, the lyophilized form offers superior stability compared to solution preparations.

How conserved is MT-ND3 across different Peromyscus species and what implications does this have for research models?

Comparative sequence analysis reveals significant conservation of MT-ND3 across Peromyscus species, with notable variations in specific functional regions:

SpeciesKey Sequence FeaturesUniProt IDNotable Amino Acid Differences
P. sejugisMNMLTALLVNITLSMLLIIVAFWFFQLNLYTEKANPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMYNTNIMMLTAFILISVLALGLAYEWLQKGLEWTEQ96114Threonine-rich N-terminal region
B. tayloriMNMIMVISVNIILSSTLILVAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPIPWAIQMPDMKTMMLTAFILVSILALGLAYEWTQKGLEWTEO21584Isoleucine substitutions in N-terminal region
P. melanotis(Sequence not provided in search results)Not specifiedPresumed to share conservation patterns with other Peromyscus species

The conservation patterns suggest functional constraints on specific regions of the protein, particularly in the transmembrane domains and in regions involved in Complex I assembly. Research models should consider these inter-species variations when extrapolating findings across different Peromyscus species or to human MT-ND3.

What methodological approaches are recommended for studying species-specific differences in MT-ND3 function?

When investigating species-specific differences in MT-ND3 function, researchers should employ:

  • Recombinant expression of variants from different species under identical conditions

  • Comparative structural analysis using protein modeling techniques

  • Functional assays measuring electron transport capacity in reconstituted systems

  • Mitochondrial isolation protocols that preserve native protein interactions

  • Site-directed mutagenesis to examine the impact of species-specific amino acid differences

These approaches allow for controlled comparison of functional differences while minimizing experimental variables that might confound interpretation of species-specific effects.

How are MT-ND3 mutations linked to Leigh syndrome and what experimental approaches best characterize this relationship?

MT-ND3 mutations have been established as causal factors in Leigh syndrome, a severe neurodegenerative disorder . The pathogenic mechanisms involve:

  • Disruption of Complex I assembly and function

  • Impaired oxidative phosphorylation capacity

  • Increased reactive oxygen species production

  • Metabolic dysregulation in highly aerobic tissues, particularly brain

Researchers studying this relationship should implement a multi-modal approach:

  • Next-generation sequencing (NGS) to quantify heteroplasmy levels in patient samples

  • Mapping mutations to the reference mitochondrial genome (NC_012920)

  • Correlation analysis between mutation load and disease severity

  • Functional characterization using cell models harboring patient-derived mutations

Statistical approaches should include Pearson correlation analysis to evaluate relationships between mutation load and clinical parameters, with significance threshold typically set at p < 0.05 .

What role does MT-ND3 heteroplasmy play in neurodegenerative diseases and how can this be accurately quantified?

MT-ND3 heteroplasmy (the presence of both wild-type and mutant mitochondrial DNA) has significant implications for neurodegenerative diseases including Alzheimer's disease (AD) . Key research findings indicate:

Accurate quantification methodologies include:

  • Whole genome sequencing with specialized mitochondrial DNA mapping protocols

  • NGS analysis with sufficient depth to detect low-frequency variants

  • Comparison of heteroplasmy across multiple tissue types from the same subject

  • Control for age-related accumulation of heteroplasmic variants

Research has demonstrated that MT-ND3 expression levels correlate with the presence of specific mitochondrial variants, suggesting a complex interaction between nuclear and mitochondrial genomes in disease pathogenesis .

How can mitochondrial base editing technologies be applied to study MT-ND3 function in vivo?

Recent advances in mitochondrial base editing enable precise modification of MT-ND3 in vivo, opening new avenues for functional studies. The DdCBE (DddA-derived cytosine base editor) system represents a breakthrough approach:

  • Design considerations for targeting MT-ND3:

    • TALE domains must be designed to bind mitochondrial DNA light (L) and heavy (H) strands

    • Target sequence selection should consider the presence of thymine-cytosine (TC) consensus sites

    • DddA toxin splits (G1333 or G1397) must be appropriately paired for efficient editing

  • Experimental workflow:

    • In vitro validation in cell culture models (e.g., NIH/3T3 cells)

    • FACS selection of transfected cells

    • Analysis of editing efficiency by Sanger sequencing and NGS

    • Adeno-associated viral (AAV) delivery for in vivo applications

    • Verification of editing persistence in post-mitotic tissues

A successful example is the DdCBE-Nd3-9577 system which achieves ~43% editing efficiency of specific cytosines in the mouse MT-ND3 gene, resulting predominantly in the G40K mutation . This approach enables functional characterization of specific amino acid changes without requiring germline transmission of mitochondrial mutations.

What analytical methods best characterize the impact of MT-ND3 mutations on mitochondrial respiratory chain function?

To comprehensively assess the impact of MT-ND3 mutations on respiratory chain function, researchers should implement:

  • High-resolution respirometry to measure oxygen consumption rates

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to assess Complex I assembly

  • Enzyme activity assays specific to NADH:ubiquinone oxidoreductase

  • Mitochondrial membrane potential measurements using potentiometric dyes

  • In silico modeling of mutation effects on protein structure and subunit interactions

  • Metabolomic profiling to identify downstream consequences of respiratory chain dysfunction

These approaches should be applied to both recombinant protein systems and cellular/animal models harboring the mutations of interest. Correlation between in vitro findings and in vivo phenotypes provides the most robust understanding of mutation impacts.

How can recombinant MT-ND3 be used to develop therapeutic approaches for mitochondrial diseases?

Recombinant MT-ND3 provides a valuable tool for therapeutic development through several approaches:

  • Drug screening platforms:

    • Structure-based virtual screening targeting MT-ND3 interaction surfaces

    • High-throughput assays measuring Complex I activity in the presence of candidate compounds

    • Binding affinity measurements between recombinant MT-ND3 and potential stabilizing molecules

  • Immunological approaches:

    • Development of antibodies for targeted delivery of therapeutic cargo to mitochondria

    • Immunoprecipitation studies to identify protein-protein interactions disrupted in disease states

  • Gene therapy considerations:

    • Optimization of AAV-mediated delivery of mitochondrial base editing systems

    • Age-dependent efficacy assessment (younger subjects show higher editing efficiency)

    • Tissue-specific targeting strategies for neurons and other affected cell types

Recombinant protein can also serve as a standard for quantifying endogenous MT-ND3 in patient samples, potentially enabling biomarker development for disease progression monitoring.

What are the most promising research directions for understanding MT-ND3's role in Complex I assembly and function?

Emerging research directions with significant potential include:

  • Cryo-electron microscopy studies of Complex I incorporating wild-type and mutant MT-ND3 to resolve structural changes

  • Investigation of post-translational modifications specific to MT-ND3 that regulate Complex I activity

  • Systems biology approaches integrating proteomics, transcriptomics, and metabolomics data

  • Exploration of tissue-specific effects of MT-ND3 variants, particularly in highly aerobic tissues

  • Development of tissue-specific mouse models with controlled heteroplasmy levels

The role of MT-ND3 in the active/deactive transition of Complex I represents a particularly promising avenue for investigation, as this regulatory function may provide therapeutic opportunities to modulate energy metabolism in disease states .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.