Recombinant Peroxisomal coenzyme A diphosphatase ndx-8 (ndx-8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndx-8; Y87G2A.14; Peroxisomal coenzyme A diphosphatase ndx-8; Nudix hydrolase 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
ndx-8
Target Protein Sequence
MKCVVSRADDLKRMLDLSDVPTKSQGEQDAGVLILLHDDGSEKLKVLLCVRSRQLRRHPG EVCFPGGMMDDEDGQNVRRTAIREAYEEVGVNENDDYLVLGNLPAFRARFGVLIHPTVAL LRRPPTFVLSIGEVESIFWIPLSQFLEDTHHSTFLIDEFYMVHVFQFDEYPTTYGVTALM CIVVAIGLLGKLPNFNLMGNLTISDMLDKHLDSIEIIRHVYEFASRKFEPKSKI
Uniprot No.

Target Background

Function
Recombinant Peroxisomal coenzyme A diphosphatase ndx-8 (ndx-8) is a coenzyme A diphosphatase that catalyzes the cleavage of CoA into 3',5'-ADP and 4'-phosphopantetheine.
Database Links
Protein Families
Nudix hydrolase family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of NDX-8?

The primary structure of NDX-8 consists of 234 amino acids with the following sequence: MKCVVSRADDLKRMLDLSDVPTKSQGEQDAGVLILLHDDGSEKLKVLLCVRSRQLRRHPGEVCFPGGMMDDEDGQNVRRTAIREAYEEVGVNENDDYLVLGNLPAFRARFGVLIHPTVALLRRPPTFVLSIGEVESIFWIPLSQFLEDTHHSTFLIDEFYMVHVFQFDEYPTTYGVTALMCIVVAIGLLGKLPNFNLMGNLTISDMLDKHLDSIEIIRHVYEFASRKFEPKSKI . The protein contains the characteristic nudix box motif (GX5EX7REUXEEXGU, where U represents a hydrophobic residue), which is essential for its catalytic activity. While the crystal structure of C. elegans NDX-8 has not been fully resolved, homology modeling based on related nudix hydrolases suggests a conserved α/β fold with the nudix box forming part of the active site. The enzyme likely requires divalent metal ions, particularly magnesium, for optimal catalytic activity, similar to other nudix hydrolase family members.

How does NDX-8 function in peroxisomal metabolism?

NDX-8 plays a regulatory role in peroxisomal metabolism by hydrolyzing CoA and acyl-CoAs to produce 3',5'-ADP and 4'-phosphopantetheine derivatives. Based on studies of mammalian homologs like NUDT7, NDX-8 likely demonstrates preferential activity toward medium-chain acyl-CoAs compared to free CoA . This suggests that the enzyme primarily functions in regulating the levels of specific acyl-CoA species within peroxisomes rather than solely controlling free CoA levels. The regulation of acyl-CoA levels is crucial for peroxisomal β-oxidation, as excessive accumulation of these intermediates can inhibit β-oxidation enzymes and disrupt metabolic processes. Additionally, by preventing the accumulation of potentially toxic acyl-CoA species, NDX-8 may play a protective role in maintaining peroxisomal homeostasis and function.

What are the proper storage and handling conditions for recombinant NDX-8?

For optimal stability and activity, recombinant NDX-8 should be stored at -20°C, with extended storage recommended at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol that is optimized for protein stability . To maintain enzyme activity, it is crucial to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of function. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . When handling the enzyme, maintain sterile conditions and use appropriate pipetting techniques to minimize protein denaturation. Prior to enzymatic assays, it may be beneficial to perform a buffer exchange to remove glycerol if it interferes with the intended application. Standard recombinant NDX-8 is available in 50 μg quantities, though other quantities may be available upon request for larger-scale experiments .

What are the recommended assay conditions for measuring NDX-8 activity?

Based on studies with related nudix hydrolases, optimal assay conditions for measuring NDX-8 enzymatic activity typically include: buffer composition of 50 mM Tris-HCl (pH 7.5-8.0), 5-10 mM MgCl₂ as a cofactor, 1-2 mM DTT or 0.5 mM TCEP as reducing agents, and substrate concentrations ranging from 50-200 μM of acyl-CoA or CoA derivatives . The reaction is typically conducted at 25-37°C for 10-30 minutes, with enzyme concentrations carefully titrated to ensure linear reaction kinetics. Activity can be measured through several analytical methods, including HPLC analysis of reaction products, coupled enzymatic assays, or colorimetric detection of released phosphate. For accurate kinetic measurements, it is advisable to determine the linear range of the enzyme activity with respect to both time and enzyme concentration before performing detailed kinetic analyses. Temperature and pH optimization should be conducted specifically for NDX-8, as optimal conditions may differ somewhat from those of mammalian homologs.

How can substrate specificity of NDX-8 be determined?

Determining the substrate specificity of NDX-8 requires a systematic approach using a panel of potential substrates. Based on studies with the mouse homolog NUDT7α, which shows highest activity towards medium-chain acyl-CoAs , a recommended substrate panel would include:

Substrate CategorySpecific CompoundsConcentration Range (μM)
Free CoACoenzyme A50-200
Short-chain acyl-CoAsAcetyl-CoA, Propionyl-CoA, Butyryl-CoA50-200
Medium-chain acyl-CoAsHexanoyl-CoA (C6), Octanoyl-CoA (C8), Decanoyl-CoA (C10)50-200
Long-chain acyl-CoAsPalmitoyl-CoA (C16), Stearoyl-CoA (C18)50-200
Branched-chain acyl-CoAsIsobutyryl-CoA, Isovaleryl-CoA50-200
Modified acyl-CoAsMalonyl-CoA, Succinyl-CoA, Hydroxymethylglutaryl-CoA50-200

Each substrate should be tested under identical reaction conditions, and activity measurements can be normalized to determine relative activity. HPLC analysis can be employed to detect and quantify the specific reaction products (3',5'-ADP and acyl-phosphopantetheine). Michaelis-Menten kinetic parameters (Km and kcat) should be determined for substrates displaying significant activity to fully characterize the enzyme's catalytic efficiency and substrate preference.

What controls should be included when working with recombinant NDX-8?

For rigorous experimental design when working with recombinant NDX-8, several controls should be incorporated:

  • Negative enzyme control: Reaction mixture without NDX-8 to account for non-enzymatic substrate degradation or background signal in detection methods.

  • Heat-inactivated enzyme control: NDX-8 that has been denatured by heating at 95°C for 10 minutes to confirm that observed activity is due to the active enzyme.

  • Buffer control: Complete reaction mixture without substrate to account for potential contaminating activities.

  • Positive control: If available, a well-characterized nudix hydrolase with known activity (such as recombinant NUDT7) to validate assay conditions.

  • Divalent cation dependency control: Reactions with EDTA (5-10 mM) to chelate metal ions and demonstrate the metal ion dependency of the enzyme.

  • Substrate specificity control: Include structurally related non-substrate molecules to confirm specificity.

  • pH and temperature controls: Multiple reaction conditions to establish optimal environmental parameters for enzyme activity.

These controls ensure that experimental results are reliable and specifically attributable to NDX-8 activity, rather than contaminating enzymes or non-enzymatic processes.

What techniques are available for studying NDX-8 expression patterns?

Several complementary techniques can be employed to study NDX-8 expression patterns in C. elegans and other experimental systems:

  • RT-qPCR: Real-time quantitative PCR can measure ndx-8 mRNA levels across different tissues, developmental stages, or experimental conditions. This approach requires designing specific primers for the ndx-8 gene and appropriate reference genes for normalization.

  • In situ hybridization: This technique localizes ndx-8 mRNA in fixed tissue samples, providing spatial information about gene expression. RNA probes complementary to ndx-8 mRNA can be designed based on the known sequence (Y87G2A.14) .

  • Promoter-reporter constructs: Generating transgenic C. elegans with the ndx-8 promoter driving expression of a fluorescent protein (e.g., GFP) allows visualization of gene expression patterns in living organisms across developmental stages.

  • Immunohistochemistry: Using antibodies specific to NDX-8 enables protein localization within tissues and subcellular compartments. If commercial antibodies are unavailable, recombinant NDX-8 can be used to generate custom antibodies.

  • Western blotting: This technique quantifies NDX-8 protein levels in tissue homogenates or subcellular fractions, allowing comparison across experimental conditions.

By combining these approaches, researchers can develop a comprehensive understanding of NDX-8 expression patterns at both the transcript and protein levels.

What is the role of NDX-8 in regulating peroxisomal CoA/acyl-CoA homeostasis?

NDX-8 likely plays a crucial role in maintaining the balance of CoA and acyl-CoA species within peroxisomes. Studies with mammalian homologs suggest that these enzymes function as "CoA thrifts" by regulating the availability of CoA for metabolic processes . Although peroxisomal membranes appear impermeable to free CoA, peroxisomes maintain their own CoA pool, likely entering as acyl-CoAs . By hydrolyzing acyl-CoAs, NDX-8 may regulate substrate availability for β-oxidation and prevent the accumulation of potentially inhibitory acyl-CoA intermediates. Under certain metabolic conditions like fasting or exposure to peroxisome proliferators, peroxisomal CoA levels increase in mammalian systems, correlating with decreased expression/activity of NUDT7α . This inverse relationship suggests that down-regulation of these enzymes may support increased β-oxidation capacity by preserving the peroxisomal CoA pool. The precise regulatory mechanisms controlling NDX-8 activity in response to metabolic demands remain an important area for future investigation.

How can researchers address contradictory results in NDX-8 activity assays?

When confronting contradictory results in NDX-8 activity assays, researchers should systematically investigate several potential sources of variation:

  • Enzyme quality assessment: Verify protein integrity through SDS-PAGE, size exclusion chromatography, or mass spectrometry. Protein aggregation or degradation can significantly impact activity measurements.

  • Assay condition standardization: Systematically evaluate the effects of buffer composition, pH, temperature, and metal ion concentrations. Minor variations in these parameters can dramatically affect nudix hydrolase activity.

  • Substrate purity verification: Confirm the purity of CoA and acyl-CoA substrates, as these compounds can degrade during storage. LC-MS analysis can verify substrate integrity.

  • Detection method validation: Employ multiple independent methods to measure enzyme activity (e.g., HPLC analysis of products, coupled enzyme assays, and direct detection of released phosphate).

  • Kinetic parameter determination: Generate complete Michaelis-Menten curves rather than single-point measurements to identify potential inhibitory effects at high substrate concentrations.

  • Post-translational modification analysis: Investigate whether NDX-8 undergoes post-translational modifications that might affect its activity under different experimental conditions.

  • Interlaboratory validation: Establish collaborations to independently verify key findings using standardized protocols across different research groups.

By systematically addressing these factors, researchers can resolve contradictions and establish reliable protocols for characterizing NDX-8 activity.

What genetic approaches can be used to study NDX-8 function in C. elegans?

Several genetic approaches can be employed to investigate NDX-8 function in C. elegans:

  • RNAi knockdown: Design specific dsRNA targeting the ndx-8 gene (Y87G2A.14) for RNA interference. This approach allows for tissue-specific or inducible knockdown by utilizing tissue-specific promoters or RNAi-sensitized strains.

  • CRISPR/Cas9 gene editing: Generate precise mutations or deletions in the ndx-8 gene to create loss-of-function or specific point mutations. This can also be used to introduce fluorescent protein tags for protein localization studies.

  • Transgenic overexpression: Create strains overexpressing wild-type or mutant NDX-8 under various promoters to assess gain-of-function phenotypes or for rescue experiments.

  • Transcriptional reporters: Develop ndx-8 promoter-driven fluorescent reporters to monitor gene expression patterns across tissues and developmental stages.

  • Suppressor screens: Perform genetic screens to identify suppressors or enhancers of ndx-8 mutant phenotypes, revealing genetic interactions and functional pathways.

  • Metabolomic analysis: Compare acyl-CoA profiles and other metabolites between wild-type and ndx-8 mutant worms under various conditions (e.g., fasting, dietary interventions).

  • Epistasis analysis: Combine ndx-8 mutations with mutations in related metabolic pathways to determine functional relationships and hierarchies.

These approaches can be combined to develop a comprehensive understanding of NDX-8 function in peroxisomal metabolism and its broader impact on organismal physiology.

How should kinetic data for NDX-8 be analyzed?

Proper analysis of NDX-8 kinetic data requires a systematic approach:

  • Initial velocity determination: Calculate initial reaction velocities from linear portions of progress curves, typically the first 5-10% of substrate conversion to avoid product inhibition effects.

  • Michaelis-Menten kinetic modeling: Fit initial velocity data to the Michaelis-Menten equation to determine key parameters:

    v=Vmax×[S]Km+[S]v = \frac{V_{max} \times [S]}{K_m + [S]}

    Where v is the reaction velocity, Vmax is the maximum velocity, [S] is substrate concentration, and Km is the Michaelis constant.

  • Linear transformations: Use transformations such as Lineweaver-Burk (double-reciprocal) plots to identify deviations from standard Michaelis-Menten kinetics:

    1v=KmVmax×1[S]+1Vmax\frac{1}{v} = \frac{K_m}{V_{max}} \times \frac{1}{[S]} + \frac{1}{V_{max}}

  • Alternative kinetic models: For cases showing substrate inhibition, apply the appropriate modified equation:

    v=Vmax×[S]Km+[S]+[S]2Kiv = \frac{V_{max} \times [S]}{K_m + [S] + \frac{[S]^2}{K_i}}

    Where Ki is the substrate inhibition constant.

  • Statistical validation: Apply statistical tests to compare kinetic parameters across different substrates or experimental conditions. Standard errors and confidence intervals should be reported for all parameters.

  • Software tools: Utilize specialized enzyme kinetics software (e.g., GraphPad Prism, DynaFit, or KinTek Explorer) for more complex models or global fitting approaches.

This systematic approach ensures reliable determination of kinetic parameters that can be compared across different experimental conditions or between NDX-8 and related enzymes.

How can researchers distinguish between direct and indirect effects of NDX-8 manipulation?

Distinguishing between direct and indirect effects of NDX-8 manipulation requires a multi-faceted experimental approach:

  • In vitro reconstitution: Perform assays with purified recombinant NDX-8 and defined substrates to establish direct enzymatic activities and substrate specificities. This provides a baseline for interpreting more complex cellular phenotypes.

  • Catalytically inactive controls: Generate and express catalytically inactive NDX-8 mutants (typically by mutating key residues in the nudix box motif) to distinguish between enzymatic and potential non-enzymatic or structural roles of the protein.

  • Temporal analysis: Implement time-course experiments to determine the sequence of events following NDX-8 manipulation, with direct effects typically manifesting more rapidly than secondary effects.

  • Substrate rescue experiments: In NDX-8 knockdown or knockout models, test whether supplementation with specific metabolites can rescue observed phenotypes. This can help identify the critical metabolic pathways affected by NDX-8 deficiency.

  • Targeted metabolomics: Focus on direct substrates and products of NDX-8 activity (acyl-CoAs, CoA, 3',5'-ADP, and phosphopantetheine derivatives) to identify immediate metabolic consequences of enzyme manipulation.

  • Genetic interaction studies: Perform epistasis analysis by combining NDX-8 manipulation with perturbations of known upstream or downstream factors to establish pathway relationships.

  • Systems biology approach: Integrate transcriptomic, proteomic, and metabolomic data to distinguish primary effects from secondary adaptive responses through pathway enrichment and network analyses.

By combining these approaches, researchers can confidently attribute observed phenotypes to specific aspects of NDX-8 function and distinguish them from secondary or compensatory effects.

What statistical approaches are most appropriate for NDX-8 functional studies?

The appropriate statistical approaches for NDX-8 functional studies depend on the specific experimental design and data characteristics:

  • Enzyme kinetics: For comparing kinetic parameters (Km, Vmax, kcat) across different substrates or conditions:

    • Non-linear regression with confidence intervals

    • Extra sum-of-squares F-test to compare different kinetic models

    • Analysis of covariance (ANCOVA) for comparing linear portions of kinetic curves

  • Expression studies: For analyzing NDX-8 expression levels across different conditions:

    • Two-tailed t-tests for pairwise comparisons

    • ANOVA with appropriate post-hoc tests (e.g., Tukey's or Dunnett's) for multiple comparisons

    • Linear mixed-effects models for time-course or repeated-measures designs

  • Phenotypic analyses: For evaluating phenotypes in NDX-8 manipulation studies:

    • Chi-square tests for categorical outcomes

    • Kaplan-Meier analysis with log-rank tests for survival or time-to-event data

    • Multivariate analysis for complex phenotypes with multiple parameters

  • Metabolomic data: For analyzing changes in metabolite profiles:

    • Principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) for dimensionality reduction

    • False discovery rate (FDR) correction for multiple testing when analyzing many metabolites

    • Pathway enrichment analysis to identify metabolic pathways significantly affected

  • Sample size considerations: A priori power analysis should be performed to determine appropriate sample sizes, particularly for experiments with potentially subtle phenotypes.

  • Reproducibility measures: Report biological and technical replicates clearly, and consider robust statistical methods that are less sensitive to outliers when appropriate.

These statistical approaches ensure rigorous analysis of NDX-8 functional data and facilitate meaningful interpretations of experimental results.

How can NDX-8 research contribute to understanding human peroxisomal disorders?

Research on NDX-8 in C. elegans can provide valuable insights into human peroxisomal disorders through several avenues:

  • Conserved metabolic pathways: Despite evolutionary distance, many peroxisomal metabolic pathways are conserved between nematodes and humans. Understanding how NDX-8 regulates peroxisomal CoA/acyl-CoA homeostasis in C. elegans can inform similar processes in human cells mediated by homologs like NUDT7 and NUDT19.

  • Disease modeling: C. elegans ndx-8 mutants can serve as simplified models for studying aspects of peroxisomal disorders, particularly those affecting lipid metabolism. The transparency and genetic tractability of C. elegans facilitate high-throughput screening approaches not feasible in mammalian models.

  • Metabolic stress responses: Studying how NDX-8 deficiency affects responses to metabolic stressors (e.g., fasting, high-fat diets) in C. elegans can provide insights into how perturbed CoA metabolism contributes to disease pathogenesis under metabolic stress conditions.

  • Therapeutic target validation: If pharmacological modulation of NDX-8 activity mitigates metabolic phenotypes in C. elegans models, this could suggest similar approaches for human peroxisomal disorders through targeting NUDT7 or related enzymes.

  • Genetic interaction networks: Systematic genetic interaction studies in C. elegans can reveal functional relationships between NDX-8 and other peroxisomal proteins, potentially identifying novel factors involved in peroxisomal disorders.

By leveraging the experimental advantages of C. elegans while focusing on conserved aspects of peroxisomal metabolism, NDX-8 research can contribute significantly to our understanding of human peroxisomal disorders and potential therapeutic approaches.

What are the challenges in translating findings from C. elegans NDX-8 to mammalian systems?

Several challenges must be addressed when translating findings from C. elegans NDX-8 studies to mammalian systems:

Addressing these challenges requires careful comparative studies and validation of key findings across multiple model systems before extrapolating to human health and disease.

How can CRISPR/Cas9 technology be applied to study NDX-8 function?

CRISPR/Cas9 technology offers powerful approaches for studying NDX-8 function in C. elegans and other model systems:

  • Knockout models: Generate complete ndx-8 gene deletions to study loss-of-function phenotypes:

    • Design sgRNAs targeting the 5' and 3' regions of the ndx-8 gene (Y87G2A.14)

    • Screen for deletions using PCR and confirm by sequencing

    • Characterize metabolic, developmental, and stress response phenotypes

  • Point mutations: Create specific mutations to study structure-function relationships:

    • Introduce mutations in the nudix box motif to abolish catalytic activity

    • Generate mutations in potential regulatory regions or protein interaction domains

    • Create amino acid substitutions that may alter substrate specificity

  • Endogenous tagging: Insert fluorescent or affinity tags at the endogenous locus:

    • C-terminal GFP fusion to visualize native expression patterns and subcellular localization

    • FLAG or HA tags for immunoprecipitation studies to identify protein interaction partners

    • Proximity labeling tags (e.g., TurboID) to identify proteins in the vicinity of NDX-8

  • Conditional alleles: Develop temperature-sensitive or auxin-inducible degron-tagged versions for temporal control:

    • Insert degron tags to enable inducible protein degradation

    • Generate promoter replacements for tissue-specific expression

  • HDR templates: Design homology-directed repair templates that include:

    • Homology arms (500-1000 bp) flanking the target site

    • Desired mutations or insertions

    • Selection markers for efficient screening

  • Validation strategies: Confirm gene editing outcomes through:

    • Genomic PCR and sequencing

    • Western blotting to verify protein expression

    • Enzyme activity assays to confirm functional consequences

CRISPR/Cas9 approaches enable precise genetic manipulations that can significantly advance our understanding of NDX-8 function in peroxisomal metabolism and organismal physiology.

What are the future research directions for NDX-8 studies?

Several promising research directions can advance our understanding of NDX-8 function and its broader implications:

  • Comparative biochemistry: Systematic comparison of substrate specificity and kinetic parameters between C. elegans NDX-8 and mammalian homologs (NUDT7, NUDT19) to identify conserved and divergent properties. This will establish the evolutionary trajectory of these enzymes and validate C. elegans as a model for studying peroxisomal CoA metabolism.

  • Structural biology: Determination of NDX-8 crystal structure, ideally in complex with substrates or product analogs, would provide critical insights into the molecular basis of substrate recognition and catalysis. These structural data could inform the design of specific inhibitors or activators for manipulating enzyme activity.

  • Systems biology approaches: Integration of transcriptomics, proteomics, and metabolomics in ndx-8 mutant backgrounds under various metabolic conditions (fasting, high-fat feeding, metabolic stress) to comprehensively map the impact of NDX-8 function on cellular metabolism beyond peroxisomes.

  • In vivo imaging: Development of fluorescent sensors for CoA and acyl-CoA species to visualize the dynamic changes in these metabolites in living organisms in response to NDX-8 manipulation, providing spatial and temporal resolution of enzyme function.

  • Translational research: Investigation of human NUDT7 variants identified in genomic databases to determine their functional consequences and potential contributions to metabolic disorders. C. elegans could serve as a platform for rapid functional characterization of these variants.

  • Pharmacological modulation: Development of specific inhibitors or activators of NDX-8 and its mammalian homologs as tools for acute manipulation of enzyme activity, complementing genetic approaches and potentially leading to therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.