Recombinant Persephonella marina NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock
Cat. No.
BT2044100
Source
in vitro E.coli expression system
Synonyms
nuoK; PERMA_1417; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Quick Inquiry

Description

Functional Roles in the NQR Complex

The NADH-quinone oxidoreductase (NQR) complex catalyzes the oxidation of NADH and reduction of quinone, coupling this redox reaction to the translocation of sodium ions across the membrane in certain bacteria . Subunit nuoK is part of this multi-subunit enzyme, though its specific function remains under investigation.

Proposed Mechanisms

  • Structural Support: Stabilizes the NQR complex architecture, enabling electron transfer and ion translocation .

  • Electron Transfer: May contribute to the binding of cofactors (e.g., flavins, Fe-S clusters) critical for redox activity .

  • Sodium Motive Force: In organisms like Vibrio cholerae, the NQR generates a sodium gradient, but Persephonella marina’s nuoK has not been explicitly linked to sodium pumping .

Research Applications

The recombinant nuoK protein is valuable for studying bacterial respiration and developing therapeutic interventions.

Key Applications

ApplicationDetails
ELISA DevelopmentUsed as an antigen in ELISA kits for detecting anti-nuoK antibodies .
Structural StudiesHis-tag enables affinity chromatography for crystallization or cryo-EM .
Inhibitor ScreeningAssays to identify compounds disrupting NQR activity .
Biochemical CharacterizationKinetic studies of NADH oxidation and quinone reduction .

Comparative Analysis with Related Subunits

While nuoK from Persephonella marina is distinct, its role mirrors subunits in other NQR complexes:

OrganismSubunitKey Features
Vibrio choleraeNqrFFAD cofactor involved in ROS production .
Prevotella spp.NqrABCDEFSodium translocation linked to anaerobic respiration .
Persephonella marinanuoKHis-tagged, full-length, thermophilic stability .

Challenges and Future Directions

  • Limited Functional Data: Specific roles of nuoK in Persephonella marina remain unclear, necessitating further mutagenesis or cryo-EM studies.

  • Thermophily: Its stability at high temperatures makes it ideal for studying extremophile biochemistry.

  • Therapeutic Potential: Inhibiting NQR in pathogens could target metabolic vulnerabilities, though Persephonella marina is non-pathogenic .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; PERMA_1417; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Persephonella marina (strain DSM 14350 / EX-H1)
Target Names
nuoK
Target Protein Sequence
MVPYEYYVVLSGLLMVLGLIGIIIRKNLIAMLLSTELMLNAVNIAFVAFDMKLYDVSGQV FVFFILTIAAAEAAVGLGLIMAIYRLRKDVDVNTLTELKL
Uniprot No.
C0QR89

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links

KEGG: pmx:PERMA_1417

STRING: 123214.PERMA_1417

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.