Recombinant Petromyzon marinus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

General Information

Petromyzon marinus, an ancient vertebrate, offers valuable insights into the evolution of various biological systems. Cytochrome c oxidase in P. marinus is essential for understanding the metabolic adaptations in these organisms . MT-CO2, encoded by the mitochondrial genome, is highly conserved across species, making it an interesting subject for evolutionary and functional studies.

Structure and Function

MT-CO2 is a transmembrane protein that facilitates electron transfer from cytochrome c to the catalytic core of COX. It contains copper centers that are essential for its redox activity.

Key structural and functional aspects include:

  • Redox Activity: MT-CO2 facilitates the transfer of electrons, which is critical for ATP production.

  • Copper Centers: The copper A center (CuA) in MT-CO2 accepts electrons from cytochrome c .

  • Proton Pumping: COX is coupled with proton translocation across the mitochondrial membrane, contributing to the electrochemical gradient .

Recombinant Production

Recombinant production of Petromyzon marinus MT-CO2 involves cloning the MT-CO2 gene from P. marinus, expressing it in a suitable host organism (e.g., E. coli), and purifying the expressed protein. The process typically includes:

  1. Gene Isolation: Extracting and amplifying the MT-CO2 gene from Petromyzon marinus DNA.

  2. Cloning: Inserting the MT-CO2 gene into an expression vector.

  3. Expression: Transforming the vector into a host organism for protein production.

  4. Purification: Isolating MT-CO2 protein using affinity chromatography or other methods .

Research Significance

Studying recombinant Petromyzon marinus MT-CO2 provides insights into:

  • Evolutionary Biology: Comparing MT-CO2 sequences and structures across different species helps elucidate evolutionary relationships .

  • Enzyme Mechanisms: Understanding the detailed mechanisms of electron transfer and proton pumping in COX .

  • Mitochondrial Dysfunction: Investigating the role of MT-CO2 mutations in mitochondrial diseases.

  • Drug Development: Identifying potential drug targets by studying the structure and function of MT-CO2 .

Data and Findings

While specific data tables and detailed research findings for recombinant Petromyzon marinus MT-CO2 are not available, research on cytochrome c oxidase and its subunits in other organisms provides a framework. For example, studies on other species have shown:

  • Inhibition Studies: Certain compounds can inhibit COX activity, affecting ATP production .

  • Structural Analysis: X-ray crystallography reveals detailed atomic structures of COX subunits, including MT-CO2 .

  • Mutational Analysis: Mutations in MT-CO2 can lead to impaired enzyme function and disease .

ParameterDescription
Molecular WeightApproximately 26 kDa (estimated based on other species)
Redox PotentialVaries based on experimental conditions
Sequence IdentityHigh conservation with other vertebrate MT-CO2 sequences
Expression SystemCommonly expressed in E. coli or yeast
Purification TagOften includes His-tag or other affinity tags
Activity AssayMeasures the rate of electron transfer from cytochrome c to oxygen
InhibitorsCyanide, azide, and CO are known inhibitors of COX
Structural StudiesX-ray crystallography and cryo-EM provide high-resolution structures
Evolutionary RateRelatively slow evolutionary rate due to functional constraints
Clinical RelevanceMutations linked to mitochondrial myopathy and other disorders

Carbonic Anhydrase Isozyme

Research indicates the presence of a high-activity carbonic anhydrase isozyme in the red blood cells of Petromyzon marinus . This enzyme facilitates carbon dioxide transport, enhancing the physiological adaptations of this ancient vertebrate .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Petromyzon marinus (Sea lamprey)
Target Names
Target Protein Sequence
MAQQAQLGLQDAASPIMEELIHFHDHTLTVVFLISVLIFYLIIVMVTTTFMNKHSLDSQE VEIVWTVMPAIVLITIALPSLRILYLTDEISNPHLTIKAVGHQWYWSYEYTDYHQMEFDS YMIPTNELEPGGIRLLDVDHRIVVPMESPVRMLITSEDVIHSWTIPSLGTKVDAVPGRLN QATFITTRPGLFFGQCSEICGANHSFMPIALEAVPLSNFENWTTKVLAS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes (Complex II, Complex III, and Complex IV) that facilitate electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (in subunit 2) and heme a (in subunit 1) to the binuclear center (BNC) in subunit 1, composed of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 in Petromyzon marinus and how does it differ from other vertebrates?

Cytochrome c oxidase subunit 2 (MT-CO2) in Petromyzon marinus is one of the core components of the respiratory Complex IV encoded by mitochondrial DNA. As in other vertebrates, it functions in the electron transport chain to transfer electrons from cytochrome c to molecular oxygen. The MT-CO2 protein contains two transmembrane alpha-helices in its N-terminal domain and houses the crucial binuclear copper A center (CuA) in its structure .

To study these differences in detail, researchers typically perform sequence alignments and structural comparisons between lamprey MT-CO2 and its homologs in other vertebrates, focusing especially on conserved functional domains like the CuA center and transmembrane regions.

Why is recombinant expression of Petromyzon marinus MT-CO2 important for research?

Recombinant expression of Petromyzon marinus MT-CO2 provides several key advantages for research:

  • It allows for production of sufficient quantities of protein for structural and functional studies without the need to harvest large numbers of animals from the wild.

  • It enables site-directed mutagenesis experiments to investigate specific amino acid residues that may be responsible for functional differences between lamprey and other vertebrates.

  • It facilitates the study of the protein's biophysical properties, including electron transfer capabilities, redox potential, and interaction with other components of the respiratory chain.

  • It provides an opportunity to study the unique properties of an agnathan respiratory protein, contributing to our understanding of mitochondrial evolution.

The method for recombinant expression typically involves utilizing the System I (CcmABCDEFGH) bacterial cytochrome c biogenesis pathway, which can efficiently attach heme groups to produce functional holocytochrome proteins .

What is the significance of studying MT-CO2 in an ancient species like Petromyzon marinus?

Studying MT-CO2 in Petromyzon marinus offers unique insights into evolutionary biology and mitochondrial function for several reasons:

  • Evolutionary perspective: Sea lampreys belong to the jawless fish lineage (Agnatha) that diverged from the vertebrate lineage approximately 500 million years ago. Studying their mitochondrial proteins provides a window into ancestral vertebrate respiratory metabolism .

  • Metabolic adaptations: Sea lampreys undergo a dramatic metamorphosis from filter-feeding larvae to parasitic adults, with significant changes in their energy demands and metabolism. MT-CO2, as a key component of the electron transport chain, likely plays an important role in these metabolic transitions .

  • Comparative physiology: Differences in MT-CO2 structure and function between lampreys and gnathostomes may reveal alternative solutions to the challenges of respiratory metabolism that emerged early in vertebrate evolution .

  • Conservation biology: Sea lampreys are invasive in some ecosystems (particularly the Great Lakes) and threatened in others. Understanding their basic biology, including energy metabolism, can inform conservation and control efforts .

A thorough investigation typically involves comparative genomic approaches and functional studies across multiple species to identify lamprey-specific adaptations in the MT-CO2 protein.

What are the optimal expression systems for recombinant Petromyzon marinus MT-CO2?

The optimal expression systems for recombinant Petromyzon marinus MT-CO2 must address several challenges specific to mitochondrially-encoded membrane proteins:

Bacterial Expression Systems:
E. coli remains the most accessible system for recombinant cytochrome expression, particularly when utilizing the System I (CcmABCDEFGH) cytochrome c biogenesis pathway. This system facilitates proper heme attachment, which is essential for functional cytochrome proteins . Key optimization strategies include:

  • Use of specialized E. coli strains engineered to express the complete CcmABCDEFGH system

  • Codon optimization of the lamprey MT-CO2 sequence for bacterial expression

  • Use of fusion tags (His6, GST, or MBP) to enhance solubility and facilitate purification

  • Expression at lower temperatures (16-20°C) to reduce inclusion body formation

  • Supplementation with δ-aminolevulinic acid to enhance heme biosynthesis

Eukaryotic Expression Systems:
For applications requiring native post-translational modifications, eukaryotic systems may be preferable:

  • Yeast systems (S. cerevisiae or P. pastoris) provide a mitochondrial environment

  • Insect cell systems using baculovirus vectors

  • Mammalian cell expression for closest approximation to native folding environment

The choice of expression system should be guided by experimental objectives, with bacterial systems favored for structural studies requiring high protein yields, and eukaryotic systems preferred for functional studies demanding native protein conformation.

What purification protocol yields the highest activity for recombinant Petromyzon marinus MT-CO2?

A multi-step purification protocol optimized for maintaining the structural integrity and enzymatic activity of recombinant Petromyzon marinus MT-CO2 typically includes:

Membrane Protein Extraction:

  • Cell lysis via French press or sonication in buffer containing 50 mM sodium phosphate (pH 7.5), 300 mM NaCl, and protease inhibitors

  • Differential centrifugation to isolate membrane fractions (10,000 × g followed by 100,000 × g)

  • Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration

Chromatographic Purification:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged protein

  • Ion exchange chromatography on a Q-Sepharose column with a linear salt gradient

  • Size exclusion chromatography as a final polishing step

Activity Preservation Measures:

  • Maintain detergent concentration above CMC throughout purification

  • Include stabilizing agents such as glycerol (10%) and reducing agents

  • Avoid freeze-thaw cycles which reduce activity dramatically

  • Consider lipid supplementation to maintain native-like environment

The purified protein can be assessed for integrity using heme staining techniques and spectroscopic methods to confirm the presence of properly incorporated heme . Activity assays typically measure electron transfer from cytochrome c to oxygen using standard polarographic or spectrophotometric methods.

How can researchers verify the proper folding and heme incorporation in recombinant Petromyzon marinus MT-CO2?

Verification of proper folding and heme incorporation in recombinant Petromyzon marinus MT-CO2 requires multiple complementary techniques:

Spectroscopic Methods:

  • UV-visible spectroscopy: Properly folded cytochrome c oxidase exhibits characteristic absorption peaks at approximately 420 nm (Soret band) and 550-600 nm (α and β bands) when reduced

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure elements

  • Electron paramagnetic resonance (EPR) spectroscopy: Confirms the proper coordination environment of the copper centers

Functional Assays:

  • Oxygen consumption measurements using a Clark-type electrode

  • Electron transfer kinetics from reduced cytochrome c

  • Proton pumping efficiency across reconstituted proteoliposomes

Structural Verification:

  • Heme staining after SDS-PAGE separation to confirm covalent heme attachment

  • Mass spectrometry to verify the exact mass and potential post-translational modifications

  • Limited proteolysis to assess the compactness of the protein structure

A properly folded and active recombinant MT-CO2 should exhibit spectroscopic properties similar to those of the native protein isolated from sea lamprey mitochondria, with appropriate adjustments for the recombinant expression system used.

What are the key considerations when designing experiments to study the functional properties of recombinant Petromyzon marinus MT-CO2?

When designing experiments to study functional properties of recombinant Petromyzon marinus MT-CO2, researchers should consider:

Experimental Controls:

  • Parallel experiments with recombinant human or other vertebrate MT-CO2 for comparative analysis

  • Inclusion of site-directed mutants targeting conserved residues in the copper binding site

  • Both positive controls (native mitochondrial preparations) and negative controls (inactive mutants)

Physiological Relevance:

  • Temperature considerations: Experiments should account for the poikilothermic nature of sea lampreys, testing activity across a temperature range of 4-25°C

  • pH conditions: Test across the physiological pH range encountered during the lamprey lifecycle

  • Oxygen concentration: Consider the variable oxygen environments lampreys encounter

Methodological Approaches:

  • Enzyme kinetics studies (oxygen consumption, cytochrome c oxidation)

  • Proton pumping efficiency measurements

  • Inhibitor sensitivity profiles (e.g., cyanide, azide, carbon monoxide)

  • Redox potential determinations of the copper centers

Lifecycle Considerations:
Given the dramatic metamorphosis sea lampreys undergo from filter-feeding larvae to parasitic adults, functional studies should consider potential differences in MT-CO2 activity or regulation across life stages . This could involve comparing recombinant protein properties with native enzyme isolated from different life stages.

How can researchers address the challenge of low expression yields when working with recombinant Petromyzon marinus MT-CO2?

Low expression yields are a common challenge when working with mitochondrially-encoded membrane proteins like MT-CO2. Researchers can implement several strategies to address this:

Optimization of Expression Systems:

  • Test multiple expression vectors with different promoter strengths

  • Explore alternative signal sequences to improve membrane targeting

  • Implement codon optimization specific to the expression host

  • Create fusion constructs with well-expressed partner proteins

Culture Condition Optimization:

  • Systematic screening of induction parameters (temperature, inducer concentration, timing)

  • Supplementation with heme precursors and trace elements

  • Use of specialized media formulations for membrane protein expression

  • Scale-up to high-density fermentation systems

Protein Engineering Approaches:

  • Design of minimal functional constructs removing problematic regions

  • Introduction of stabilizing mutations based on computational predictions

  • Generation of chimeric constructs incorporating well-expressed regions from homologous proteins

Alternative Detection Methods:
For applications requiring only small amounts of protein, highly sensitive detection methods can be employed:

  • Fluorescence-based activity assays

  • Surface plasmon resonance for interaction studies

  • Single-molecule techniques for mechanistic investigations

Researchers should systematically document optimization attempts in a comprehensive table format:

Optimization ParameterVariations TestedRelative Yield ImprovementNotes
Expression temperature37°C, 30°C, 25°C, 18°C25°C: 2.1-fold increaseLower temperatures reduce inclusion body formation
Induction time2h, 4h, 8h, overnightOvernight: 1.8-fold increaseExtended expression time beneficial
Media compositionLB, TB, 2xYT, M9TB: 3.2-fold increaseRich media with glycerol supports higher cell density
Codon optimizationNon-optimized vs. optimizedOptimized: 5.4-fold increaseEssential for heterologous expression

What are the most informative comparative analyses when studying Petromyzon marinus MT-CO2 relative to other species?

Comparative analyses provide crucial evolutionary and functional context for Petromyzon marinus MT-CO2 research. The most informative comparisons include:

Sequence-Based Comparisons:

  • Multiple sequence alignments across vertebrate lineages, highlighting lamprey-specific substitutions

  • Identification of selection signatures (dN/dS ratios) in functional domains

  • Analysis of conservation patterns in copper-binding sites and transmembrane regions

Structural Comparisons:

  • Homology modeling based on high-resolution structures from other species

  • Molecular dynamics simulations to identify potential functional differences

  • Docking studies with interaction partners (cytochrome c, oxygen)

Functional Comparisons:

  • Enzyme kinetic parameters (Km, Vmax, catalytic efficiency) across species

  • Proton pumping efficiency relative to electron transport

  • Inhibitor sensitivity profiles and binding affinities

  • Thermal and pH stability profiles

Evolutionary Context:
The phylogenetic position of lampreys as basal vertebrates makes them particularly valuable for understanding respiratory protein evolution. Comparisons should include representatives from:

  • Other agnathans (hagfish)

  • Cartilaginous fish

  • Ray-finned fish

  • Tetrapods

  • Non-vertebrate chordates (e.g., amphioxus, tunicates)

A published comparative analysis found that lamprey thyroid hormone receptors (which function as nuclear receptors like many proteins involved in mitochondrial biogenesis) phylogenetically group together prior to the gnathostome TRα/β split, suggesting that lampreys retain ancestral characteristics in many nuclear and mitochondrial proteins .

How can recombinant Petromyzon marinus MT-CO2 be used to study the evolutionary adaptations in the mitochondrial respiratory chain?

Recombinant Petromyzon marinus MT-CO2 provides a unique window into vertebrate respiratory chain evolution and can be utilized in several advanced research applications:

Ancestral State Reconstruction:

  • Creation of chimeric proteins combining domains from lamprey and gnathostome MT-CO2

  • Resurrection of predicted ancestral MT-CO2 sequences through computational reconstruction

  • Functional comparison of reconstructed ancestral proteins with modern lamprey MT-CO2

Adaptive Evolution Analysis:

  • Identification of lamprey-specific amino acid substitutions in MT-CO2

  • Characterization of their functional consequences through site-directed mutagenesis

  • Correlation with the unique life history and metabolic demands of lampreys

Interspecies Compatibility Studies:

  • Testing the ability of lamprey MT-CO2 to form functional complexes with subunits from other species

  • Evaluating the co-evolution of nuclear-encoded and mitochondrially-encoded respiratory subunits

  • Investigating species-specific differences in assembly factors and chaperones

The phylogenetic position of lampreys makes them invaluable for understanding how mitochondrial functions evolved during early vertebrate evolution. The lamprey genome assembly has revealed that this species retained ancestral characteristics in many genes and chromosomal arrangements , suggesting that their mitochondrial proteins may similarly preserve ancestral features.

What insights can be gained from studying the interaction between recombinant Petromyzon marinus MT-CO2 and other components of the respiratory chain?

Studying interactions between recombinant Petromyzon marinus MT-CO2 and other respiratory chain components provides insights into:

Complex Assembly and Stability:

  • Reconstitution experiments combining recombinant MT-CO2 with other Complex IV subunits

  • Analysis of assembly intermediates using blue native PAGE

  • Thermostability measurements of fully assembled complexes versus individual subunits

Electron Transfer Kinetics:

  • Measurement of electron transfer rates between cytochrome c and Petromyzon marinus MT-CO2

  • Determination of binding affinities between interaction partners

  • Comparison with kinetics from other species to identify evolutionary adaptations

Supercomplexes Formation:

  • Investigation of Petromyzon marinus respiratory supercomplex formation

  • Functional consequences of supercomplex assembly on electron transfer efficiency

  • Evolutionary implications for the emergence of supercomplex organization

Regulatory Interactions:

  • Effects of post-translational modifications on MT-CO2 function

  • Interaction with tissue-specific isoforms of other respiratory components

  • Response to cellular signaling pathways that regulate respiratory activity

How does the MT-CO2 function change during the sea lamprey lifecycle, and how can recombinant expression help study these changes?

Sea lampreys undergo a dramatic metamorphosis from filter-feeding larvae to parasitic adults, accompanied by significant physiological and metabolic changes. Recombinant expression can help elucidate MT-CO2 functional shifts across this lifecycle:

Lifecycle-Specific Regulation:

  • Comparison of MT-CO2 sequences and expression levels across lamprey life stages

  • Investigation of post-translational modifications specific to different stages

  • Analysis of potential isoform switching or alternative processing

Metabolic Reprogramming:

  • Functional characterization of MT-CO2 activity under conditions mimicking different life stages

  • Correlation with observed changes in metabolic rate during metamorphosis

  • Integration with other physiological changes, such as the development of parasitic feeding structures

Hormonal Regulation:
Sea lamprey metamorphosis involves significant hormonal changes, including fluctuations in thyroid hormone levels . Research has shown that thyroid hormones in lampreys follow a pattern contrary to other metamorphosing vertebrates, with elevated levels in larvae that decline during metamorphosis . Recombinant expression systems can be used to investigate:

  • Direct effects of hormones on MT-CO2 activity

  • Changes in protein-protein interactions under different hormonal conditions

  • Potential co-regulation of nuclear and mitochondrial genes encoding respiratory proteins

Experimental Approach Table:

Life StagePhysiological StateExpected MT-CO2 FunctionExperimental Approaches
Larval (ammocoete)Filter-feeding, sedentarySteady-state, moderate activityMeasure baseline kinetic parameters, response to temperature
MetamorphosingTransitional, non-feedingPotential downregulation, restructuringMonitor structural changes, assembly state, hormone response
Parasitic juvenileActive predation, high energy demandEnhanced activity, increased efficiencyAssess maximal turnover rates, efficiency under stress conditions
Spawning adultReproductive phase, cease feedingTerminal changes, possible degradationInvestigate stability, susceptibility to degradation pathways

Research has shown that metamorphosis in lampreys involves significant changes in hormone levels and gene expression , making this an ideal system for studying how MT-CO2 function adapts to different metabolic demands throughout a complex lifecycle.

What are the most common technical challenges when expressing and purifying recombinant Petromyzon marinus MT-CO2, and how can they be overcome?

Researchers face several technical challenges when working with recombinant Petromyzon marinus MT-CO2, each requiring specific solutions:

Challenge 1: Mitochondrial Genetic Code Differences
Sea lamprey mitochondrial genomes use a slightly modified genetic code compared to standard nuclear code, potentially leading to translation errors.

Solutions:

  • Create synthetic genes with codon optimization for the expression host

  • Specifically check and modify any AUA codons (isoleucine in standard code, methionine in mitochondrial)

  • Account for differences in stop codon usage

Challenge 2: Membrane Protein Solubility
MT-CO2 contains transmembrane domains that make soluble expression challenging.

Solutions:

  • Screen multiple detergents systematically (DDM, LMNG, GDN, Fos-choline)

  • Utilize specialized E. coli strains designed for membrane protein expression

  • Consider fusion with solubility-enhancing tags (MBP, SUMO)

  • Employ cell-free expression systems in the presence of nanodiscs or liposomes

Challenge 3: Heme Incorporation
Proper incorporation of cofactors is essential for functional recombinant cytochromes.

Solutions:

  • Co-express with the complete System I (CcmABCDEFGH) cytochrome c biogenesis pathway

  • Supplement growth media with δ-aminolevulinic acid to enhance heme biosynthesis

  • Implement heme staining protocols to confirm successful incorporation

  • Optimize expression conditions to match the kinetics of heme biosynthesis

Challenge 4: Low Yield and Stability
Mitochondrial membrane proteins often express at low levels and show limited stability.

Solutions:

  • Scale up culture volumes to compensate for low per-cell yield

  • Identify and modify unstable regions through targeted mutagenesis

  • Implement high-throughput stability screening using differential scanning fluorimetry

  • Develop rapid purification protocols to minimize exposure to destabilizing conditions

How can researchers effectively study the copper binding site in recombinant Petromyzon marinus MT-CO2?

The binuclear copper center (CuA) in MT-CO2 is crucial for electron transfer function. Effective study requires specialized approaches:

Spectroscopic Characterization:

  • UV-visible spectroscopy to monitor the characteristic absorption features of the CuA center

  • EPR spectroscopy to analyze the paramagnetic properties of the copper site

  • X-ray absorption spectroscopy (XAS) to determine precise copper coordination geometry

  • Resonance Raman spectroscopy to probe metal-ligand interactions

Mutagenesis Approaches:

  • Site-directed mutagenesis of conserved copper-binding residues (histidines and cysteines)

  • Creation of a systematic library of point mutations around the copper site

  • Charge-swap experiments to test electrostatic contributions to electron transfer

Metal Substitution Studies:

  • Reconstitution with alternative metals (e.g., zinc) to probe structure-function relationships

  • Isotopic labeling with 63Cu/65Cu for advanced spectroscopic studies

  • Comparison of kinetic parameters with different metal occupancy states

Computational Approaches:

  • Quantum mechanical/molecular mechanical (QM/MM) calculations of electron transfer pathways

  • Molecular dynamics simulations of copper site flexibility under different conditions

  • Electrostatic calculations to map the electron transfer landscape

The copper binding site in MT-CO2 is located in a conserved cysteine loop at positions equivalent to 196 and 200 in human MT-CO2, with a conserved histidine at position 204 . Comparative analysis between lamprey and human sites can reveal evolutionary adaptations in this critical functional center.

What are the best approaches for studying the interaction between recombinant Petromyzon marinus MT-CO2 and cytochrome c?

The interaction between MT-CO2 and cytochrome c is central to respiratory function. Studying this interaction requires:

Binding Affinity Measurements:

  • Surface plasmon resonance (SPR) to determine association and dissociation kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Microscale thermophoresis for measurements in near-native conditions

  • Co-immunoprecipitation assays for qualitative interaction assessment

Functional Interaction Studies:

  • Electron transfer kinetics using stopped-flow spectroscopy

  • Oxygen consumption measurements to correlate binding with catalytic activity

  • Cross-linking coupled with mass spectrometry to identify interaction interfaces

  • Competition assays with inhibitors or antibodies targeting specific epitopes

Structural Approaches:

  • Cryo-electron microscopy of the complex in nanodiscs

  • X-ray crystallography of co-crystallized proteins or stabilized complexes

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Computational docking validated by experimental constraints

Species-Specific Comparisons:

  • Cross-species activity assays using cytochrome c from different vertebrates

  • Chimeric constructs swapping interaction domains between species

  • Evolutionary rate analysis of interaction interfaces

Experimental data should be compiled into comprehensive interaction profiles as shown in this example table:

ParameterLamprey MT-CO2 with Lamprey Cyt cLamprey MT-CO2 with Human Cyt cFold Difference
Binding Kd8.3 × 10⁻⁷ M2.7 × 10⁻⁶ M3.3× weaker
kon1.5 × 10⁵ M⁻¹s⁻¹7.8 × 10⁴ M⁻¹s⁻¹1.9× slower
koff0.12 s⁻¹0.21 s⁻¹1.8× faster
Electron transfer rate42 s⁻¹18 s⁻¹2.3× slower
Interface buried area1120 Ų980 Ų1.1× smaller

What are the future research directions for recombinant Petromyzon marinus MT-CO2 studies?

Future research on recombinant Petromyzon marinus MT-CO2 presents several promising directions:

Structural Biology Frontiers:

  • High-resolution structural determination of the complete lamprey cytochrome c oxidase complex

  • Time-resolved structural studies to capture the protein during the catalytic cycle

  • Comparative structural analysis with other agnathans and early-diverging vertebrates

Evolutionary Applications:

  • Reconstruction of ancestral vertebrate MT-CO2 sequences and functional testing

  • Investigation of co-evolutionary patterns between mitochondrial and nuclear-encoded subunits

  • Integration with the improved sea lamprey genome assembly to study mitochondrial evolution in the context of programmatic DNA elimination during development

Biomedical Relevance:

  • Comparative studies with human MT-CO2 mutations associated with mitochondrial diseases

  • Exploration of unique features that might inform therapeutic approaches

  • Investigation of lamprey-specific adaptations that could inspire biomimetic applications

Ecological and Conservation Applications:

  • Development of lamprey-specific metabolic biomarkers based on MT-CO2 function

  • Assessment of environmental contaminant effects on respiratory function

  • Integration with lamprey control strategies in invasive contexts

The sea lamprey's unique phylogenetic position and complex lifecycle make its mitochondrial proteins valuable models for understanding both the fundamental principles of respiratory chain function and the evolutionary processes that shaped vertebrate energy metabolism.

How can findings from Petromyzon marinus MT-CO2 research be applied to broader questions in evolutionary and comparative biochemistry?

Research on Petromyzon marinus MT-CO2 contributes to broader questions in evolutionary and comparative biochemistry through:

Vertebrate Respiratory Evolution:

  • Elucidation of ancestral states in mitochondrial electron transport

  • Understanding the evolutionary trajectory of oxygen utilization mechanisms

  • Insight into how early vertebrates adapted their energy metabolism during the transition to more active lifestyles

Metabolic Adaptation Mechanisms:

  • Molecular basis for adaptation to different oxygen environments

  • Comparative analysis of metabolic regulation across diverse vertebrate lineages

  • Models for studying extreme metabolic transitions during metamorphosis

Evolutionary Biochemistry Principles:

  • Case studies in protein co-evolution between mitochondrial and nuclear genomes

  • Investigation of structure-function relationships in ancient proteins

  • Examples of how fundamental biochemical processes are modified through evolution while maintaining essential functions

Practical Applications:

  • Insights for the design of more efficient biocatalysts

  • Models for understanding mitochondrial disease mechanisms

  • Development of species-specific inhibitors for lamprey control in invasive contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.