Recombinant Petromyzon marinus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Context

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a mitochondrially encoded protein that serves as a critical component of the respiratory chain Complex I (NADH:ubiquinone oxidoreductase). In Petromyzon marinus, commonly known as the sea lamprey, this protein plays an essential role in energy metabolism by participating in the electron transfer process that drives ATP synthesis. The sea lamprey represents a basal vertebrate lineage that diverged from the vertebrate evolutionary tree approximately 550 million years ago, making its mitochondrial proteins particularly valuable for comparative evolutionary studies .

Sea lampreys have gained significant attention not only for their evolutionary significance but also due to their status as invasive species in the Laurentian Great Lakes, where they have negatively impacted ecologically and economically important fish populations for nearly a century . Understanding the molecular biology of this species, including the structure and function of proteins like MT-ND3, contributes to both basic science and potential applied research related to lamprey biology.

Classification and Nomenclature

MT-ND3 belongs to the broader family of NADH dehydrogenase proteins. The specific nomenclature used to describe this protein includes:

  • Recommended name: NADH-ubiquinone oxidoreductase chain 3

  • Enzyme Commission number: EC 1.6.5.3

  • Alternative names: NADH dehydrogenase subunit 3

  • Gene name: MT-ND3

  • Gene synonyms: MTND3, NADH3, ND3

  • UniProt accession number: Q35540 (for Petromyzon marinus)

The "MT" prefix in MT-ND3 denotes the mitochondrial origin of this gene, as it is encoded by the mitochondrial genome rather than the nuclear genome, which is characteristic of many components of the electron transport chain.

Role in Cellular Metabolism

MT-ND3 serves as an integral component of Complex I of the mitochondrial respiratory chain, which is the first and largest enzyme complex in the electron transport chain. This complex catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q), coupled with the translocation of protons across the inner mitochondrial membrane. This process contributes to establishing the electrochemical gradient that drives ATP synthesis.

The specific role of MT-ND3 within Complex I appears to be associated with the membrane domain of the complex, where it participates in forming the proton translocation pathway. As a small, hydrophobic protein, MT-ND3 likely contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane.

Enzymatic Activity

The enzymatic activity of MT-ND3 as part of Complex I is reflected in its EC number (1.6.5.3), which classifies it as an oxidoreductase acting on NADH or NADPH with quinone or similar compound as acceptor . The reaction catalyzed by the complex can be summarized as:

NADH+ubiquinone+5Hmatrix+NAD++ubiquinol+4Hintermembrane space+\text{NADH} + \text{ubiquinone} + 5\text{H}^+_{\text{matrix}} \rightarrow \text{NAD}^+ + \text{ubiquinol} + 4\text{H}^+_{\text{intermembrane space}}

While MT-ND3 itself does not directly bind substrates or cofactors, its positioning within Complex I is critical for maintaining the structural integrity and functional efficiency of the entire complex.

Expression Systems and Methodology

Recombinant Petromyzon marinus MT-ND3 protein is typically produced using bacterial expression systems. While the specific details for Petromyzon marinus MT-ND3 production are not fully described in the available search results, we can draw from information about similar recombinant proteins, such as Podomys floridanus MT-ND3, which is expressed in E. coli .

The production process generally involves:

  1. Cloning the MT-ND3 gene into an appropriate expression vector

  2. Transformation of the vector into a bacterial host (typically E. coli)

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Purification of the recombinant protein

For facilitated purification, the recombinant protein is often produced with an affinity tag, such as a polyhistidine (His) tag. The tag type for the Petromyzon marinus MT-ND3 recombinant protein is determined during the production process .

Applications in Evolutionary and Comparative Biology

The availability of recombinant Petromyzon marinus MT-ND3 provides valuable opportunities for research in evolutionary and comparative biology. The sea lamprey occupies a unique position in vertebrate evolution, as it belongs to the oldest extant vertebrate lineage (Cyclostomata). Comparative studies involving MT-ND3 from sea lamprey and other vertebrates can provide insights into the evolution of mitochondrial function and the respiratory chain.

Recent advances in sea lamprey genome assembly have enabled more detailed analyses of the evolutionary history of various genes, including those encoding mitochondrial proteins . The improved genome assembly for sea lamprey has resolved highly contiguous chromosomes and permitted reconstructions of gene evolution, revealing major roles of interchromosomal segmental duplication, intrachromosomal duplication, and positive selection in long-term evolution .

Applications in Biomedical Research

Mitochondrial dysfunction is associated with numerous human diseases, including neurodegenerative disorders, metabolic diseases, and aging-related conditions. Studies involving recombinant MT-ND3 can contribute to understanding the structural and functional aspects of Complex I, which may have implications for understanding mitochondrial pathologies.

Additionally, the sea lamprey has been used as a model organism for various biomedical research areas, including spinal cord regeneration and immune system evolution. While the direct applications of recombinant MT-ND3 in these areas are not explicitly described in the search results, the availability of well-characterized recombinant proteins from this species enhances the toolkit available for lamprey-based research.

Applications in Ecological Research and Management

Sea lampreys are invasive in the Great Lakes and have significant ecological and economic impacts . Research on sea lamprey biology, including biochemical studies involving recombinant proteins like MT-ND3, can contribute to understanding the physiological basis of lamprey adaptations and potentially inform management strategies.

Current management approaches include the use of lampricides such as 3-trifluoromethyl-4-nitrophenol (TFM) to control larval sea lamprey populations . While there is no direct link between MT-ND3 and TFM susceptibility described in the search results, comprehensive understanding of lamprey biochemistry and metabolism could potentially inform the development or refinement of control methods.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly specify your requirements when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice for shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Typically, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Petromyzon marinus (Sea lamprey)
Target Names
Target Protein Sequence
MNSFMVMIMLTLTLSSIMALLAFWLPIMKPDSEKLSPYECGFDPQGSARLPFSLRFFLVA ILFLLFDLEIALLLPSPWATNISNPEFTLLWASLFVLLLTLGLIYEWLQGGLDWAE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its role in mitochondrial function?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a mitochondrially-encoded protein that serves as an essential component of Complex I (NADH:ubiquinone oxidoreductase) in the electron transport chain. This integral membrane protein plays a critical role in the first step of mitochondrial respiration, facilitating electron transfer from NADH to ubiquinone.

In Petromyzon marinus (sea lamprey), MT-ND3 is of particular interest due to the species' phylogenetic position as a jawless vertebrate, representing one of the oldest extant vertebrate lineages. The protein typically consists of approximately 115 amino acids forming transmembrane domains that contribute to the core structure of Complex I . Functionally, MT-ND3 participates in proton pumping across the inner mitochondrial membrane, contributing to the establishment of the electrochemical gradient necessary for ATP synthesis.

How does MT-ND3 in Petromyzon marinus differ from that in other species?

The MT-ND3 protein in Petromyzon marinus maintains the core functional domains common to other vertebrates but exhibits sequence variations reflecting its evolutionary position. While specific sequence information for P. marinus MT-ND3 is not comprehensively documented in the provided search results, comparative analysis with other species like Bos mutus grunniens (which has 115 amino acids in its MT-ND3) reveals conservation of key functional domains alongside species-specific variations .

These evolutionary differences make P. marinus MT-ND3 valuable for studying the evolution of mitochondrial respiratory components. As a basal vertebrate lineage that diverged over 500 million years ago, sea lamprey mitochondrial proteins offer insights into the ancestral state of vertebrate respiratory chains .

Why is recombinant production of MT-ND3 from Petromyzon marinus valuable for research?

Recombinant production of P. marinus MT-ND3 enables:

  • Structural studies without the need to isolate native protein from limited animal tissue

  • Mutation analysis to assess functional domains and critical residues

  • Production of specific antibodies for investigational studies

  • Comparative biochemical analyses with MT-ND3 from other species

  • Investigation of functional properties in controlled experimental systems

These approaches are particularly valuable given the unique evolutionary position of sea lamprey, allowing researchers to investigate mitochondrial function across evolutionary time.

What expression systems are most effective for producing recombinant Petromyzon marinus MT-ND3?

While specific optimization data for P. marinus MT-ND3 expression is not provided in the search results, effective expression systems can be inferred from similar mitochondrial membrane proteins:

E. coli expression systems:

  • BL21(DE3) strains with T7 promoter systems are commonly used for mitochondrial protein expression

  • Addition of an N-terminal His-tag facilitates purification and detection

  • Codon optimization may be necessary for efficient expression in bacterial systems

For membrane proteins like MT-ND3, specialized strains such as C41(DE3) or C43(DE3) that better tolerate membrane protein overexpression are recommended to increase yield and reduce toxicity.

Alternative expression systems:

  • Insect cell systems (baculovirus) may provide better folding for complex membrane proteins

  • Cell-free systems can be effective for producing challenging membrane proteins like MT-ND3

  • Yeast systems (Pichia pastoris) offer eukaryotic processing capabilities

The most appropriate system should be selected based on the specific research application and required protein quality.

What purification strategies are recommended for recombinant MT-ND3?

Recommended purification strategies for recombinant MT-ND3 typically include:

Affinity chromatography:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Buffer systems containing mild detergents (0.1-1% DDM, LDAO, or C12E8) to maintain membrane protein solubility

  • Gradient elution with imidazole (20-500 mM) to improve purity

Secondary purification steps:

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Ion exchange chromatography as a polishing step

Buffer considerations:

  • Inclusion of glycerol (5-10%) to enhance stability

  • Addition of reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

  • pH optimization typically between 7.0-8.0

A typical purification protocol might achieve >90% purity as determined by SDS-PAGE, similar to what has been reported for other MT-ND3 proteins .

How can recombinant MT-ND3 be used to study mitochondrial diseases?

Recombinant P. marinus MT-ND3 serves as a valuable tool for studying mitochondrial diseases through several experimental approaches:

Mutation analysis:

  • Site-directed mutagenesis of recombinant MT-ND3 can mimic disease-associated variants

  • Functional assays can then assess the impact on activity, stability, and interactions

  • This approach is particularly relevant given the association between MT-ND3 variants and neurodegenerative conditions like Alzheimer's disease

Complex I assembly studies:

  • Recombinant MT-ND3 can be used to identify binding partners and assembly intermediates

  • Co-immunoprecipitation experiments using tagged recombinant protein can map interaction networks

  • Pulse-chase experiments with labeled recombinant protein can track assembly kinetics

Structural studies:

  • Recombinant protein enables structural analysis via X-ray crystallography or cryo-EM

  • Understanding structural perturbations caused by disease-associated mutations

Research has shown that MT variants can influence gene expression of MT-ND3, as demonstrated by the finding that 10398A>G (rs2853826) acts as an expression quantitative trait loci (eQTL) for MT-ND3 . This connection between genetic variation and gene expression illustrates the potential role of MT-ND3 in disease mechanisms.

What functional assays are appropriate for characterizing recombinant MT-ND3 activity?

Several functional assays can characterize recombinant MT-ND3 activity within Complex I:

NADH:ubiquinone oxidoreductase activity assays:

  • Spectrophotometric measurement of NADH oxidation at 340 nm

  • Oxygen consumption measurements using oxygen electrodes

  • Artificial electron acceptor assays (e.g., using ferricyanide)

Reconstitution experiments:

  • Incorporation of recombinant MT-ND3 into proteoliposomes

  • Measurement of proton pumping activity using pH-sensitive fluorescent dyes

  • Assessment of membrane potential generation using potential-sensitive probes

Binding studies:

  • Surface plasmon resonance to measure interactions with other Complex I subunits

  • Isothermal titration calorimetry to determine binding affinities

  • Pull-down assays to identify interacting partners

When conducting these assays, it's essential to include appropriate controls to account for the potential effects of tags or non-native expression systems on protein function.

How does MT-ND3 heteroplasmy influence mitochondrial function and disease progression?

Mitochondrial heteroplasmy—the presence of multiple mitochondrial DNA variants within cells or tissues—has significant implications for MT-ND3 function and disease:

Heteroplasmy threshold effects:

  • Disease manifestation often requires a specific threshold of mutant mtDNA

  • For MT-ND3 variants, this threshold can vary by tissue and mutation type

  • Recombinant protein studies help determine functional consequences at various heteroplasmy levels

Heteroplasmy distribution patterns:

  • MT heteroplasmy distribution varies by tissue type

  • While blood samples show heteroplasmy throughout the entire MT genome, brain samples exhibit heteroplasmy primarily within the MT control region

  • These tissue-specific patterns may influence how MT-ND3 variants contribute to neurodegenerative conditions

This relationship between MT variants, heteroplasmy, and gene expression provides novel evidence linking MT SNPs with MT heteroplasmy and opens new avenues for investigating disease mechanisms .

How can researchers distinguish between effects caused by tagged recombinant MT-ND3 versus the native protein?

Distinguishing between effects caused by tagged recombinant MT-ND3 and the native protein requires careful experimental design:

Control strategies:

  • Tag removal experiments

    • Compare protein with and without tag after protease cleavage

    • Use different tag positions (N-terminal vs. C-terminal) to identify position-dependent effects

  • Complementary approaches

    • Parallel experiments with native protein isolated from tissue

    • Validation of key findings using in vivo models

  • Functional redundancy tests

    • Express multiple constructs with different tags

    • Compare functional parameters across constructs

Recommended experimental controls:

Control TypeImplementationPurpose
Empty vectorExpress tag-only constructControl for tag effects
Inactive mutantExpress catalytically inactive MT-ND3Distinguish specific from non-specific effects
Native isolationIsolate native Complex I from P. marinusBenchmark for recombinant protein
Heterologous expressionExpress human MT-ND3 as comparisonControl for species-specific effects

When working with His-tagged constructs, researchers should be aware that the tag might influence protein conformation or interaction surfaces. Experimental validation using multiple approaches is essential to confirm that observed effects reflect true biological functions rather than artifacts of the recombinant system .

What are the technical challenges in expressing mitochondrial membrane proteins like MT-ND3 in heterologous systems?

Expression of mitochondrial membrane proteins like MT-ND3 in heterologous systems presents several technical challenges:

Membrane integration issues:

  • Mitochondrial proteins have specific membrane insertion machinery that differs from cytoplasmic membrane systems

  • Bacterial systems lack appropriate chaperones for mitochondrial membrane protein folding

  • Improper folding can lead to inclusion body formation and low yields of functional protein

Codon usage differences:

  • Mitochondrial genomes use a different genetic code from nuclear genomes

  • Rare codons in the expression host can reduce translation efficiency

  • Codon optimization is often necessary but may affect protein folding kinetics

Post-translational modifications:

  • Mitochondrial-specific modifications may be absent in heterologous systems

  • Lack of proper modifications can affect protein stability and function

Toxicity to host cells:

  • Overexpression of membrane proteins can be toxic to host cells

  • MT-ND3 insertion into host membranes may disrupt membrane integrity

  • Inducible systems with tight expression control are often necessary

These challenges often necessitate extensive optimization of expression conditions, including temperature, induction parameters, and host cell selection. For example, expression at lower temperatures (15-25°C) and with lower inducer concentrations may improve yield of properly folded protein.

How does MT-ND3 contribute to the assembly and stability of mitochondrial Complex I?

MT-ND3 plays a crucial role in Complex I assembly and stability through several mechanisms:

Assembly pathway involvement:

  • MT-ND3 is incorporated relatively early in the Complex I assembly process

  • It forms part of a subcomplex that serves as a scaffold for subsequent assembly steps

  • Mutations in MT-ND3 can disrupt assembly, leading to reduced Complex I levels

Structural contributions:

  • MT-ND3 forms part of the membrane arm of Complex I

  • Its transmembrane helices contribute to the proton-translocation pathway

  • The protein helps stabilize interactions between other subunits within the complex

Conformational flexibility:

  • MT-ND3 contains regions that undergo conformational changes during catalysis

  • These dynamic properties are essential for coupling electron transfer to proton pumping

  • Mutations that affect this flexibility can impair Complex I function without preventing assembly

Understanding these roles is particularly valuable in studying neurodegenerative diseases, as proper Complex I assembly and stability are critical for maintaining mitochondrial function in high-energy-demanding tissues like the brain .

What are the optimal storage conditions for maintaining recombinant MT-ND3 stability?

Based on storage recommendations for similar mitochondrial membrane proteins, the following conditions are advisable for recombinant MT-ND3:

Short-term storage (up to one week):

  • Store at 4°C in appropriate buffer

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

Long-term storage:

  • Store at -20°C/-80°C in small aliquots

  • Addition of 5-50% glycerol is recommended to prevent freeze-damage

  • A final concentration of 50% glycerol is commonly used for optimal cryoprotection

Buffer considerations:

  • Tris/PBS-based buffer with pH 8.0 provides a suitable environment

  • Addition of 6% trehalose improves protein stability during freeze-thaw cycles

  • Inclusion of mild detergents maintains membrane protein solubility

Reconstitution protocols:

  • Lyophilized protein should be reconstituted in deionized sterile water

  • A concentration of 0.1-1.0 mg/mL is typically recommended

  • Brief centrifugation prior to opening vials containing lyophilized protein ensures material is collected at the bottom

Proper storage is essential for maintaining the structural integrity and functional activity of recombinant MT-ND3, particularly given its complex membrane protein nature.

What quality control measures should be employed to verify recombinant MT-ND3 integrity?

Several quality control measures should be employed to verify the integrity of recombinant MT-ND3:

Purity assessment:

  • SDS-PAGE analysis with Coomassie staining (target: >90% purity)

  • Western blotting using anti-His antibodies or specific MT-ND3 antibodies

  • Mass spectrometry to confirm molecular weight and sequence coverage

Functional verification:

  • NADH oxidation assay to confirm catalytic activity

  • Binding assays with known interaction partners

  • Circular dichroism to assess secondary structure content

Homogeneity analysis:

  • Size exclusion chromatography to detect aggregation

  • Dynamic light scattering to assess size distribution

  • Thermal shift assays to evaluate stability and proper folding

Specific activity determination:

  • Activity measurements under standardized conditions

  • Comparison to native Complex I activity (when available)

  • Inhibitor sensitivity profiles to confirm specific activity

Quality control should be performed immediately after purification and again before experimental use, particularly if the protein has been stored for extended periods. Documentation of batch-to-batch variation is essential for ensuring experimental reproducibility.

What insights can Petromyzon marinus MT-ND3 provide about the evolution of mitochondrial function?

As a representative of one of the oldest extant vertebrate lineages, Petromyzon marinus MT-ND3 offers valuable evolutionary insights:

Evolutionary conservation analysis:

  • Comparison of P. marinus MT-ND3 with other vertebrates reveals highly conserved functional domains

  • Identification of lamprey-specific variations helps understand adaptation to different energetic requirements

  • Analysis of selection pressures on different protein regions illuminates evolutionary constraints

Ancestral state reconstruction:

  • P. marinus represents a basal vertebrate lineage that diverged approximately 500 million years ago

  • Its MT-ND3 sequence helps in reconstructing the ancestral state of this protein in early vertebrates

  • Comparison with invertebrate homologs bridges the gap in understanding mitochondrial evolution across metazoans

Functional adaptation analysis:

  • Experimental comparison of recombinant P. marinus MT-ND3 with mammalian counterparts

  • Investigation of temperature sensitivity and catalytic efficiency differences

  • Assessment of interaction specificity with other Complex I components

These evolutionary insights are particularly valuable for understanding the fundamental principles of mitochondrial function that have been maintained across vast evolutionary distances, versus those features that have undergone lineage-specific adaptations.

How do genetic variations in MT-ND3 correlate with functional differences across species?

Genetic variations in MT-ND3 across species often correlate with functional adaptations:

Species-specific adaptations:

  • Variations in P. marinus MT-ND3 may reflect adaptations to its unique life cycle, including freshwater and marine phases

  • Comparisons with other aquatic vertebrates can reveal convergent adaptations

  • Analysis of sequence variations in the context of different metabolic demands provides insights into structure-function relationships

Functional implications of polymorphisms:

  • Research has shown that MT variants can act as expression quantitative trait loci (eQTLs)

  • For instance, the 10398A>G variant influences MT-ND3 expression and is associated with various disease phenotypes

  • Comparative analysis across species can identify conserved regulatory mechanisms

Understanding these variations provides insights into both the fundamental requirements for MT-ND3 function and the flexibility that allows adaptation to different physiological contexts. This knowledge is particularly valuable for interpreting the potential impact of human MT-ND3 variants in disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.