Recombinant Petromyzon marinus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized in E. coli under optimized conditions to ensure proper folding and stability :

ParameterSpecificationSource
Expression hostEscherichia coli
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage bufferTris/PBS-based, 6% Trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water

Repeated freeze-thaw cycles are discouraged; aliquots stored at -80°C maintain stability for 12 months .

Functional Role in Mitochondrial Respiration

As a core subunit of Complex I, recombinant MT-ND6 facilitates electron transfer from NADH to ubiquinone, driving proton gradient formation for ATP synthesis :
NADH+ubiquinoneNAD++ubiquinol\text{NADH} + \text{ubiquinone} \rightarrow \text{NAD}^+ + \text{ubiquinol}

Mechanistic insights:

  • Electron transport: Mediated via iron-sulfur clusters and flavin mononucleotide (FMN) .

  • Pathological relevance: Mutations in MT-ND6 homologs are linked to Leber’s hereditary optic neuropathy (LHON) and Leigh syndrome .

Comparative Analysis of Recombinant ND6 Proteins

SpeciesHost SystemPurityApplicationsSource
Petromyzon marinusE. coli>90%Structural studies, ELISA
Balaenoptera musculusCell-free>85%Disease modeling
Locusta migratoriaCell-free>85%Evolutionary studies

Experimental Uses:

  • ELISA development: Used as an antigen for antibody validation .

  • Mitochondrial disease models: Study oxidative phosphorylation defects and reactive oxygen species (ROS) generation .

Clinical and Industrial Relevance

  • Therapeutic research: Insights into MT-ND6’s role in LHON aid drug discovery targeting mitochondrial disorders .

  • Biosecurity compliance: Rigorous quality control ensures non-human consumption, adhering to biosafety standards .

Limitations and Future Directions

  • Species-specific variability: Functional differences between lamprey and human MT-ND6 may limit translational relevance .

  • Storage stability: Lyophilization preserves activity but requires stringent reconstitution protocols .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Petromyzon marinus (Sea lamprey)
Target Names
Target Protein Sequence
MLSLVLCFFVMFLLGVAVVVLSPSPYFSALGLVFVAVSGCFIVLYHGGTFLSLVLVLLYL GGMMVVFVYSAALAADPYPEVLGGRVIWFFVICVLCICFAGYMSFNDFFLDVSVACEGAD YTGGIFGAEWLGVTTFYEVGLILVLAGWALLVCLFSVLVVVRGVNRGALRAV
Uniprot No.

Target Background

Function

Recombinant Petromyzon marinus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 6 (MT-ND6) and what is its functional role in mitochondria?

MT-ND6 (mitochondrially encoded NADH dehydrogenase 6) is a protein encoded by the mitochondrial genome that functions as a critical component of Complex I in the electron transport chain. This protein is embedded in the inner mitochondrial membrane and participates in the first step of electron transport, transferring electrons from NADH to ubiquinone during oxidative phosphorylation. This process is fundamental to creating the electrochemical gradient necessary for ATP production, which serves as the primary energy currency for cellular functions .

Within the context of Complex I function, MT-ND6 contributes to maintaining the proton gradient across the inner mitochondrial membrane that drives ATP synthesis. The protein contains multiple membrane-spanning domains that facilitate its function within the lipid bilayer of the mitochondrial membrane. Its role is highly conserved across vertebrate species, suggesting its fundamental importance to cellular energy metabolism and organismal survival. Disruptions in MT-ND6 function can significantly impact mitochondrial efficiency and energy production capabilities, potentially affecting numerous physiological processes.

What methods are used to express and purify recombinant Petromyzon marinus MT-ND6?

While specific methods for Petromyzon marinus MT-ND6 are not detailed in the available literature, standard recombinant protein expression systems can be adapted for this purpose. Researchers typically employ bacterial expression systems (often E. coli), yeast systems (S. cerevisiae or P. pastoris), insect cell systems (baculovirus), or mammalian cell systems depending on the required post-translational modifications and folding requirements.

For membrane proteins like MT-ND6, specialized expression systems that facilitate proper membrane insertion are often necessary. This may include the use of detergent-based extraction methods following expression, or cell-free systems that incorporate artificial membrane environments. Purification typically involves affinity chromatography using histidine or other fusion tags, followed by size exclusion chromatography to ensure protein homogeneity. For functional studies, it is critical to verify that the recombinant protein maintains its native conformation and activity through functional assays that measure electron transfer capabilities.

How does Petromyzon marinus MT-ND6 compare structurally and functionally to homologs in other species?

Comparative analysis of MT-ND6 across species reveals both conservation of core functional domains and species-specific adaptations. While the search results don't provide direct comparison between Petromyzon marinus MT-ND6 and other species, we can infer from related information about MT-ND6 in humans and Oncorhynchus mykiss (rainbow trout) that fundamental functional domains are likely conserved .

In humans, MT-ND6 is known to be associated with Leber hereditary optic neuropathy when specific mutations occur, particularly the T14484C variant that replaces methionine with valine at position 64 . This mutation affects Complex I function and demonstrates the critical nature of specific amino acid residues in maintaining protein function. In comparing sea lamprey MT-ND6 to other species, researchers should focus on conserved functional domains while noting sequence variations that might reflect evolutionary adaptations to different environmental conditions or metabolic requirements.

The evolutionary position of lampreys as ancient vertebrates makes their MT-ND6 particularly interesting from a comparative perspective, potentially providing insights into the evolution of mitochondrial function across vertebrate lineages. Sequence alignment studies combined with structural modeling can help identify conserved functional domains and species-specific adaptations that might reflect different ecological niches or metabolic requirements.

What experimental approaches can determine how MT-ND6 function contributes to lamprey survival during lampricide exposure?

Research on sea lamprey response to 3-trifluoromethyl-4-nitrophenol (TFM), the primary lampricide used in control programs, has revealed a significant positive correlation between lamprey size and survival time during TFM exposure . This relationship suggests potential physiological mechanisms that may involve mitochondrial function, including MT-ND6 activity.

To investigate MT-ND6's specific role in this phenomenon, researchers could employ several experimental approaches:

  • Gene expression analysis: Quantify MT-ND6 expression levels before, during, and after TFM exposure across different size classes of lamprey using qPCR or RNA-Seq.

  • Mitochondrial function assays: Measure Complex I activity in isolated mitochondria from different size classes of lamprey, correlating activity with survival times.

  • Oxygen consumption measurements: Use respirometry to assess mitochondrial function in tissues from lamprey of different sizes following TFM exposure.

  • CRISPR-based approaches: Develop methods to modify MT-ND6 expression or function to directly test its contribution to TFM resistance.

  • Metabolomic analysis: Compare metabolic profiles of lamprey with different survival times to identify pathways associated with TFM resistance that might involve mitochondrial function.

Since TFM is known to disrupt oxidative phosphorylation, and larger lamprey demonstrate increased survival times (approximately 4.56 minutes per cm increase in length) , investigating how MT-ND6 function scales with body size could provide critical insights into both basic mitochondrial biology and applied lamprey control strategies.

How can researchers investigate potential mutations in Petromyzon marinus MT-ND6 that might confer resistance to lampricides?

Given that mutations in human MT-ND6 can significantly alter mitochondrial function, as seen in Leber hereditary optic neuropathy , similar variations in sea lamprey MT-ND6 might influence response to lampricides. To investigate this possibility, researchers should consider:

  • Population genetics approaches: Sequence MT-ND6 from lamprey populations with varying lampricide sensitivity to identify potential resistance-associated variants.

  • Site-directed mutagenesis: Create recombinant MT-ND6 variants with specific mutations and assess their functional properties in vitro.

  • Structure-function analysis: Model the structural impacts of identified mutations using computational approaches to predict functional consequences.

  • Heterologous expression systems: Express wild-type and mutant lamprey MT-ND6 in model organisms to evaluate functional differences in a controlled genetic background.

  • Pharmacogenomic studies: Correlate MT-ND6 sequence variations with lampricide sensitivity through dose-response experiments.

This research would benefit from establishing a baseline of natural variation in MT-ND6 across lamprey populations as a foundation for identifying potential resistance-associated mutations, particularly in populations repeatedly exposed to lampricide treatments.

What methodologies are optimal for studying interactions between recombinant MT-ND6 and other Complex I components?

Investigating protein-protein interactions within Complex I requires specialized approaches due to the membrane-embedded nature of these proteins. Recommended methodologies include:

  • Co-immunoprecipitation with antibodies against MT-ND6 or other Complex I components, followed by mass spectrometry to identify interacting partners.

  • Blue native PAGE to preserve native protein complexes, allowing visualization of intact Complex I and potentially subcomplexes containing MT-ND6.

  • Crosslinking mass spectrometry (XL-MS) to identify specific interaction sites between MT-ND6 and other Complex I subunits.

  • Fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) to monitor protein interactions in real-time in living cells.

  • Cryo-electron microscopy to determine the structure of intact Complex I with specific focus on MT-ND6 positioning and interactions.

For functional interaction studies, researchers should consider reconstitution experiments where purified recombinant MT-ND6 is incorporated into membrane systems with other Complex I components to assess assembly efficiency and functional output.

How can recombinant Petromyzon marinus MT-ND6 be used to study evolutionary aspects of mitochondrial function?

Sea lampreys (Petromyzon marinus) occupy a unique evolutionary position as one of the most ancient extant vertebrate lineages, making their mitochondrial proteins valuable for evolutionary studies. Recombinant MT-ND6 can serve as a tool for comparative analyses in several ways:

  • Sequence comparison studies: Align MT-ND6 sequences across vertebrate lineages to identify conserved domains and lineage-specific adaptations, reconstructing the evolutionary history of this critical mitochondrial protein.

  • Functional complementation experiments: Express lamprey MT-ND6 in systems with dysfunctional native MT-ND6 to assess functional conservation across large evolutionary distances.

  • Biochemical characterization: Compare enzymatic properties (substrate affinity, electron transfer rates, inhibitor sensitivity) of lamprey MT-ND6 with homologs from other vertebrate lineages to identify functional evolutionary adaptations.

  • Structural biology approaches: Determine the structure of lamprey MT-ND6 for comparison with other vertebrate MT-ND6 proteins, potentially revealing evolutionary constraints on structure-function relationships in mitochondrial proteins.

These comparative approaches could provide insights into how mitochondrial function has evolved over approximately 550 million years of vertebrate evolution and identify fundamental aspects of mitochondrial function that have remained conserved despite extensive morphological and physiological evolution.

What are the critical quality control parameters for ensuring functional integrity of recombinant MT-ND6?

Maintaining functional integrity of recombinant MT-ND6 requires rigorous quality control measures due to its hydrophobic nature and complex folding requirements. Essential quality control parameters include:

Quality Control ParameterMethodologyAcceptance Criteria
Protein puritySDS-PAGE, size exclusion chromatography>95% homogeneity
Structural integrityCircular dichroism (CD) spectroscopySecondary structure profile consistent with membrane protein
Membrane incorporationLiposome flotation assay>80% incorporation efficiency
Functional activityNADH:ubiquinone oxidoreductase activity assayActivity comparable to native Complex I
Thermal stabilityDifferential scanning fluorimetryTm consistent with stable membrane protein
Aggregation stateDynamic light scatteringMonodisperse population in detergent micelles

Additionally, researchers should verify that the purified protein contains the expected post-translational modifications and maintains proper folding through appropriate spectroscopic techniques. For functional studies, it is essential to confirm that the recombinant protein can assemble correctly with other Complex I components if applicable to the experimental design.

How can MT-ND6 research contribute to understanding size-dependent survival in lampricide treatments?

Research on larval sea lamprey has demonstrated a significant relationship between body size and survival time during TFM exposure, with larger individuals showing increased tolerance to the lampricide . Understanding MT-ND6's role in this phenomenon could provide valuable insights for lamprey control programs.

The observed relationship where survival time increases by approximately 4.56 minutes for each centimeter increase in total length suggests potential mechanisms involving mitochondrial function . Researchers could investigate:

  • Scaling relationships between body size and mitochondrial density or function, with specific focus on MT-ND6 expression levels.

  • Differences in TFM uptake, distribution, or metabolism across size classes that might involve mitochondrial function.

  • Size-dependent variations in anaerobic metabolism capacity that might compensate for TFM-induced disruption of oxidative phosphorylation.

  • Developmental changes in MT-ND6 structure or function that correlate with increased body size.

This research could inform optimization of lampricide treatment protocols based on the size distribution of lamprey populations in target streams, potentially improving treatment efficacy while minimizing environmental impacts. For example, streams with predominantly larger larvae might require extended treatment durations beyond the typical 12-hour window to achieve desired control outcomes .

How might comparative studies of MT-ND6 across lamprey species inform invasive species management?

While Petromyzon marinus has become an invasive species in the Great Lakes, other lamprey species maintain native distributions. Comparative studies of MT-ND6 across lamprey species could provide valuable insights for management:

  • Identification of species-specific MT-ND6 characteristics that might explain differential sensitivity to lampricides, potentially enabling more targeted control approaches.

  • Development of molecular markers based on MT-ND6 sequence variations for rapid species identification in management contexts.

  • Understanding fundamental differences in mitochondrial function that might contribute to invasive potential in Petromyzon marinus compared to non-invasive lamprey species.

  • Investigation of potential genetic adaptations in MT-ND6 within Great Lakes populations of sea lamprey that might reflect selection under lampricide pressure.

Comparative approaches could lead to more selective control strategies that effectively target invasive sea lamprey while minimizing impacts on native lamprey species and other aquatic organisms.

What experimental designs could best address potential evolutionary adaptation to TFM in sea lamprey populations?

The long-term application of TFM in the Great Lakes since the 1950s could potentially drive selection for resistant phenotypes. Research designs to investigate evolutionary adaptation involving MT-ND6 might include:

  • Historical genetic analysis: Compare MT-ND6 sequences from preserved specimens collected before TFM use with contemporary populations to identify potential selection signatures.

  • Common garden experiments: Rear lamprey from populations with different TFM exposure histories under identical conditions to isolate genetic components of resistance.

  • Quantitative trait locus (QTL) mapping: Identify genetic regions associated with TFM resistance, with specific focus on mitochondrial genes including MT-ND6.

  • Experimental evolution: Subject lamprey populations to controlled TFM selection regimes and monitor changes in MT-ND6 sequence and function over multiple generations.

  • Field-based resistance monitoring: Systematically compare TFM sensitivity across populations with different treatment histories, correlating with MT-ND6 sequence data.

Understanding the potential for evolutionary adaptation to lampricides is critical for the long-term sustainability of control programs. If larger lamprey have selective advantages for surviving treatments, and size (or correlated traits) is heritable, there could be potential for both physiological and life history resistance to TFM through selection for increased body size .

What integrative approaches could combine MT-ND6 research with broader ecological studies of sea lamprey?

Integrating molecular-level MT-ND6 research with broader ecological studies could provide comprehensive insights into sea lamprey biology and control. Promising integrative approaches include:

  • Combining MT-ND6 functional studies with field-based monitoring of treatment efficacy to identify potential correlations between molecular variations and population-level responses.

  • Integrating metabolomics with MT-ND6 functional studies to understand how energy metabolism pathways interact with environmental variables including lampricide exposure.

  • Developing ecological models that incorporate molecular parameters related to MT-ND6 function to better predict population dynamics and control outcomes.

  • Investigating potential links between MT-ND6 function and behavioral traits relevant to invasion success or parasitic feeding efficiency.

  • Examining how environmental factors such as temperature or water chemistry interact with MT-ND6 function to influence lamprey physiology and lampricide sensitivity.

Such integrative approaches could bridge the gap between molecular mechanisms and ecological outcomes, ultimately leading to more effective and sustainable management strategies for invasive sea lamprey populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.