Recombinant Petromyzon marinus Pineal opsin

Shipped with Ice Packs
In Stock

Description

Functional Insights

Photochemical properties:

  • Forms a green-sensitive pigment (λ<sub>max</sub> ~500 nm) when reconstituted with 11-cis-retinal

  • Activates G<sub>i</sub>-type G-proteins in heterologous expression systems

Biological roles:

  • Mediates circadian photoreception in lamprey pinealocytes

  • Co-localizes with parapinopsin-like opsins in mesencephalic neurons for polychromatic light detection

Recombinant Production

Expression system:

ParameterDetailSource
Host organismEscherichia coliCreative BioMart
TagPolyhistidine (His-tag)
Purity>95% (SDS-PAGE verified)
ApplicationsAntibody production, functional assays

Key studies:

  1. Evolutionary analysis: Demonstrated accelerated substitution rates (2.1× faster than avian pinopsins), suggesting adaptive evolution in marine environments

  2. Signal transduction: Identified divergent intracellular loops critical for pineal-specific G-protein coupling

  3. Comparative biology: Used to trace opsin gene duplication events in basal vertebrates vs. teleosts

Experimental findings:

Study FocusMethodologyOutcomeCitation
Spectral tuningHeterologous expressionStable pigment formation at pH 6.8-7.4
Cellular localizationImmunocytochemistryCiliary membrane localization in M5NS neurons
Protein interactionsYeast two-hybridNovel binding partners in phototransduction

Technical Considerations

Challenges in characterization:

  • Requires 11-cis-retinal supplementation for functional reconstitution

  • Shows reduced thermostability compared to mammalian opsins (T<sub>m</sub> = 42°C)

Best practices:

  • Use 0.1% dodecyl maltoside for membrane extraction

  • Maintain reducing conditions (5 mM DTT) to prevent oxidation

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please include any special requests for the format when placing your order, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for the most accurate delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the reconstituted protein at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Pineal opsin; Pineal gland-specific opsin; P-opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Petromyzon marinus (Sea lamprey)
Target Protein Sequence
MDALQESPPSHHSLPSALPSATGGNGTVATMHNPFERPLEGIAPWNFTMLAALMGTITAL SLGENFAVIVVTARFRQLRQPLNYVLVNLAAADLLVSAIGGSVSFFTNIKGYFFLGVHAC VLEGFAVTYFGVVALWSLALLAFERYFVICRPLGNFRLQSKHAVLGLAVVWVFSLACTLP PVLGWSSYRPSMIGTTCEPNWYSGELHDHTFILMFFSTCFIFPLAVIFFSYGKLIQKLKK ASETQRGLESTRRAEQQVTRMVVVMILAFLVCWMPYATFSIVVTACPTIHLDPLLAAVPA FFSKTATVYNPVIYIFMNKQFRDCFVQVLPCKGLKKVSATQTAGAQDTEHTASVNTQSPG NRHNIALAAGSLRFTGAVAPSPATGVVEPTMSAAGSMGAPPNKSTAPCQQQGQQQQQQGT PIPAITHVQPLLTHSESVSKICPV
Uniprot No.

Target Background

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Pineal gland.

Q&A

What are the primary pineal opsins identified in Petromyzon marinus?

Several opsins have been identified in the pineal complex of Petromyzon marinus (river lamprey), including parapinopsin, which exhibits unique photochemical properties. Studies have isolated five kinds of opsin cDNAs from the adult river lamprey pineal organ. Three of these belong to the vertebrate opsin subtype: one from the Rh group (lamprey rhodopsin), one from the Red group (lamprey red), and one from the PP group (lamprey parapinopsin). Additionally, two opsins showed highest similarity to RGR and peropsin, which are considered to act as retinal photoisomerases . The parapinopsin is of particular interest due to its UV-sensitive properties and evolutionary significance.

What are the spectral characteristics of recombinant lamprey parapinopsin?

Recombinant lamprey parapinopsin reconstituted with 11-cis-3-dehydro-retinal (retinal 2) exhibits an absorption maximum at 370 nm, placing it in the UV region of the spectrum. This is approximately 10 nm longer in wavelength than retinal 1-based lamprey parapinopsin. Upon UV light irradiation, parapinopsin converts to a photoproduct with an absorption maximum at 515 nm in the green region, demonstrating its bistable nature . This photochemical property allows the pigment to be photoconverted between two stable states depending on the wavelength of light it absorbs.

How does parapinopsin function differ from other vertebrate UV-sensitive opsins?

The primary distinction lies in parapinopsin's unique photochemical reaction. Unlike typical vertebrate UV cone opsins that bleach upon light absorption, parapinopsin exhibits a bistable nature. UV light converts parapinopsin to a stable photoproduct with an absorption maximum in the green region of the spectrum (515 nm), while subsequent green light exposure reverts it to its original UV-sensitive dark state . This interconvertible characteristic is similar to invertebrate visual opsins, melanopsins, and Opn5s, but differs fundamentally from vertebrate rod and cone visual opsins. Phylogenetic analysis shows that parapinopsin (PP group) and UV cone opsin (UV/Violet group) evolved independently in the vertebrate lineage, representing a striking example of convergent evolution .

What are the recommended protocols for isolating parapinopsin cDNA from Petromyzon marinus pineal tissue?

Based on published methodologies, the following protocol is recommended:

  • RNA Extraction: Extract total RNA from freshly dissected pineal complexes of river lamprey (Lethenteron japonica, closely related to Petromyzon marinus).

  • Reverse Transcription: Reverse transcribe the RNA to cDNA using an oligo(dT) primer.

  • PCR Amplification: Use degenerate primers targeting conserved regions of opsins:

    • Sense primer: 5′-GCGGATCCICCIITNNTNGGNTGG-3′ (corresponding to amino acid sequence PP(F/L/V/I/M)(F/L/V/I/M)GW)

    • Antisense primer: 5′-GCGAATTCIIIGC(A/G)TANGGN(C/A/G)NCCA-3′ (corresponding to WXPYAX)

  • PCR Conditions: Perform PCR amplifications with annealing temperatures of 40°C or 46°C .

  • Cloning and Sequencing: Clone the PCR products and sequence them to identify parapinopsin sequences.

This approach has successfully yielded parapinopsin cDNAs from several vertebrate species including lampreys, frogs, and fishes.

What expression systems are optimal for producing functional recombinant lamprey parapinopsin?

For functional expression of recombinant lamprey parapinopsin, mammalian cell culture systems have proven effective. The following methodology is recommended:

  • Expression Vector Construction: Clone the full-length lamprey parapinopsin cDNA into a mammalian expression vector with an appropriate promoter.

  • Cell Line Selection: Use HEK293T cells or similar mammalian cell lines for expression.

  • Transfection: Transfect cells using established methods such as calcium phosphate precipitation or lipofection.

  • Chromophore Addition: After transfection, add 11-cis-retinal or 11-cis-3-dehydro-retinal (retinal 2) to the culture medium. The latter is preferred as it is a major component of the chromophore in the pineal organ of adult lamprey .

  • Incubation: Incubate cells in darkness to allow pigment formation.

  • Membrane Preparation: Harvest cells and prepare membranes containing the reconstituted pigment for spectroscopic analysis.

This approach has successfully produced functional parapinopsin with the expected UV sensitivity and bistable photochemical properties.

What techniques are effective for analyzing the spectral properties of recombinant lamprey parapinopsin?

Several spectroscopic techniques have proven effective for analyzing the unique photochemical properties of recombinant lamprey parapinopsin:

  • UV-Visible Absorption Spectroscopy: To determine the absorption spectrum of the dark state and photoproducts. This reveals the absorption maximum at 370 nm for the dark state and 515 nm for the photoproduct .

  • Difference Spectroscopy: To analyze the spectral changes upon light irradiation. This technique can clearly demonstrate the conversion between the UV-sensitive dark state and the green-sensitive photoproduct.

  • Flash Photolysis: To study the kinetics of photochemical reactions, especially useful for examining the rapid formation of photointermediates.

  • Low-Temperature Spectroscopy: To trap and characterize photointermediates that may be too unstable to detect at room temperature.

  • pH-Dependent Spectroscopy: To examine the effects of pH on the absorption spectrum and photochemical reactions, which can provide insights into the protonation state of the chromophore and key amino acid residues.

These techniques collectively provide comprehensive information about the unique bistable nature of parapinopsin and its photochemical cycle.

How can recombinant lamprey parapinopsin be utilized to investigate evolutionary aspects of vertebrate photoreception?

Recombinant lamprey parapinopsin serves as a valuable tool for evolutionary studies of vertebrate photoreception through several approaches:

  • Comparative Genomics: By comparing the sequence and structure of lamprey parapinopsin with other opsins, researchers can trace the evolutionary history of photoreception in vertebrates. The phylogenetic analysis shows that parapinopsin belongs to the PP group, distinct from the UV/Violet group that includes UV cone opsins . This indicates that UV sensitivity evolved independently in these two opsin lineages, providing evidence for convergent evolution.

  • Ancestral State Reconstruction: Recombinant expression of lamprey parapinopsin, representing one of the most basal vertebrates, provides insights into the ancestral state of vertebrate photoreception. The bistable nature of parapinopsin, similar to invertebrate visual opsins, suggests that this property might be ancestral and was lost in the evolution of vertebrate visual opsins.

  • Functional Evolution Studies: By creating chimeric proteins or introducing site-directed mutations based on sequence comparisons between parapinopsin and other opsins, researchers can identify key residues responsible for specific functional properties, such as spectral tuning and photochemical behavior.

  • Comparative Expression Pattern Analysis: Studies of parapinopsin expression in the lamprey pineal, combined with similar studies in other vertebrates, reveal the evolution of non-visual photoreception systems. In lampreys, parapinopsin is expressed in the dorsal region of the pineal organ , while in fish and amphibians, its expression extends to other brain regions and even the retina .

These approaches collectively contribute to our understanding of how photoreception systems evolved across vertebrate lineages.

What are the neural circuit implications of the co-expression of parapinopsin-like opsin and P-opsin in lamprey brain?

The co-expression of parapinopsin-like opsin (bPPL) and P-opsin in specific neurons of the lamprey brain has significant implications for neural circuit function and light information processing:

  • Wavelength-Dependent Integration: The co-expression of bPPL (violet to blue-sensitive) and P-opsin (green-sensitive) in the same cells suggests these neurons can integrate information across different wavelength ranges, potentially enabling a form of color discrimination within individual cells .

  • Retinal Feedback Mechanisms: Some of the cells co-expressing these opsins in the M5 nucleus of Schober (M5NS) project axons to the retina, suggesting a centrifugal pathway that may modulate retinal activity based on brain photoreception . This creates a feedback loop where brain photoreception can influence visual processing.

  • Ciliary Signaling: Immunostaining has revealed that both bPPL and P-opsin are localized specifically in cilia along the third ventricle of M5NS , suggesting that these specialized structures serve as the primary site for photoreception and subsequent signal transduction.

  • G-protein Signaling Diversity: Studies show that bPPL activates Gi-type G protein in a light-dependent manner, while P-opsin-expressing cells with Go-type G protein evoke depolarizing responses to visible light . This diversity in signaling pathways allows for complex integration of light information.

This co-expression system represents a unique neural mechanism for processing light information that differs from the one-cell color opponency system observed in teleosts and reptiles, where parapinopsin and parietopsin are expressed in the same photoreceptor cell .

What molecular mechanisms underlie the bistable photochemistry of lamprey parapinopsin?

The bistable photochemistry of lamprey parapinopsin involves several molecular mechanisms:

  • Chromophore Isomerization: The primary photochemical event is the isomerization of the 11-cis retinal chromophore to all-trans configuration upon UV light absorption. This isomerization triggers conformational changes in the opsin protein, forming a stable photoproduct (metastate) with an absorption maximum at 515 nm .

  • Stable Photoproduct Formation: Unlike vertebrate visual opsins where photoactivation leads to chromophore release (bleaching), the photoproduct of parapinopsin remains stable with the all-trans chromophore firmly attached to the opsin. This stability is likely mediated by specific amino acid interactions that prevent hydrolysis of the Schiff base linkage between the chromophore and the opsin.

  • Photoregeneration Pathway: Green light absorption by the photoproduct causes re-isomerization of the all-trans chromophore back to the 11-cis configuration, regenerating the original dark state of parapinopsin. This complete photocycle allows parapinopsin to function without requiring enzymatic chromophore regeneration pathways .

  • Structural Determinants: Specific amino acid residues in the retinal-binding pocket likely contribute to the bistable nature. Comparative analysis with other opsins suggests that unique residues in transmembrane domains III, VI, and VII may be particularly important for stabilizing both the dark state and photoproduct.

  • Protonated Schiff Base Stability: The protonation state of the Schiff base linkage between the chromophore and a conserved lysine residue is likely maintained throughout the photocycle, contributing to the stability of both states.

This bistable photochemistry provides functional advantages for continuous photoreception in the pineal organ, allowing efficient UV detection even under continuous illumination.

How does the distribution and function of parapinopsin differ across vertebrate lineages?

Parapinopsin shows interesting variations in distribution and function across vertebrate lineages:

  • Cyclostomes (Lampreys): In the river lamprey, parapinopsin is expressed selectively in photoreceptor cells located in the dorsal region of the pineal organ. These cells exhibit hyperpolarizing responses with maximum sensitivity around 380 nm, matching the absorption spectrum of parapinopsin. The bistable nature of parapinopsin contributes to the UV-sensitivity of the lamprey pineal .

  • Non-teleost Fishes: RT-PCR analysis has detected pinopsin (a related pineal opsin) expression in both the brain and eyes of several non-teleost fishes, including coral catshark, spotted gar, Siberian sturgeon, gray bichir, and spotted African lungfish . This suggests a broader role in both pineal and retinal photoreception.

  • Teleost Fishes: In zebrafish, parapinopsin (PP1) contributes to color opponency in pineal photoreceptor cells. The bistable nature of parapinopsin, providing both a UV-sensitive dark state and a visible (green) light-sensitive photoproduct, achieves color discrimination within a single photoreceptor cell .

  • Amphibians: In anurans (frogs), pinopsin mRNA is expressed in both brain and eyes, while in urodelans (salamanders and newts), it is detected only in the brain . This suggests differential deployment of these opsins for visual and non-visual functions across amphibian lineages.

  • Evolution of Color Discrimination: The pineal color discrimination mechanism shows evolutionary variation. In lampreys, parapinopsin and parietopsin (P-opsin) are expressed in separate photoreceptor cells, whereas in teleosts and reptiles, they are co-expressed in the same cell, creating a "one-cell system" for color opponency .

This distribution pattern reveals the evolutionary plasticity of pineal opsins and their recruitment for diverse photoreceptive functions across vertebrate evolution.

What comparative data exists on the spectral sensitivity of parapinopsin across different species?

The available data on spectral sensitivity of parapinopsin across species reveals both conservation and adaptation:

Table 1: Comparative Spectral Properties of Parapinopsin Across Species

SpeciesDark State λmax (nm)Photoproduct λmax (nm)ChromophorePhysiological RoleReference
River Lamprey (Lethenteron japonica)37051511-cis 3-dehydro-retinalPineal UV reception
River Lamprey (Lethenteron japonica) with A1360~51011-cis retinal-
Clawed Frog (Xenopus tropicalis)~360-370*~510*-Pineal and retinal photoreception
Rainbow Trout (Oncorhynchus mykiss)~360-370*~510*-Pineal photoreception
Catfish~370*~510*-Pineal and parapineal photoreception
Zebrafish~360*~490-510*-Pineal color opponency

*Estimated values based on homology and limited spectroscopic data

Key observations from comparative studies:

  • Spectral Conservation: The UV sensitivity of parapinopsin's dark state is highly conserved across species, with absorption maxima consistently falling in the 360-370 nm range. Similarly, the photoproduct consistently absorbs in the green region (510-515 nm) .

  • Chromophore Influence: The use of different chromophores (A1 vs. A2) creates subtle shifts in absorption maxima. The lamprey parapinopsin with 11-cis 3-dehydro-retinal (A2) shows a 10 nm red-shift compared to the same opsin with 11-cis retinal (A1) .

  • Evolutionary Stability: The conservation of spectral properties suggests strong evolutionary pressure to maintain UV sensitivity in the pineal organs across diverse vertebrate lineages, despite varying ecological niches and photic environments.

  • Functional Adaptation: Despite spectral conservation, the deployment and neural integration of parapinopsin signals show considerable variation across species, suggesting adaptation at the circuit level rather than at the molecular level of the photopigment itself.

This spectral conservation across species highlights the fundamental importance of UV reception in pineal function throughout vertebrate evolution.

How can recombinant lamprey parapinopsin be utilized in optogenetic applications?

The unique properties of lamprey parapinopsin make it a promising candidate for specialized optogenetic applications:

  • Bistable Optogenetic Tool: Unlike conventional optogenetic tools that require continuous illumination or separate activating/inactivating wavelengths, parapinopsin's bistable nature allows for sustained activation after a brief UV pulse until a green light pulse is applied. This property could reduce phototoxicity and enable precise temporal control in optogenetic experiments .

  • Wavelength-Specific Signaling: By coupling parapinopsin to different G-protein signaling pathways, researchers could develop optogenetic tools that respond to UV light with high specificity, activating Gi/Go pathways that are distinct from the channels activated by existing optogenetic tools like channelrhodopsin .

  • Subcellular Targeting: The natural localization of parapinopsin to ciliary structures could be exploited to develop optogenetic tools that specifically target primary cilia or other specialized cellular compartments .

  • Reversible Modulation: The complete photoreversibility of parapinopsin allows for multiple cycles of activation/deactivation without loss of sensitivity, making it suitable for experiments requiring repeated stimulation protocols.

  • Potential Applications:

    • Studying G-protein coupled signaling pathways with temporal precision

    • Investigating the role of inhibitory G-protein signaling in neural circuits

    • Developing light-controlled gene expression systems based on G-protein signaling cascades

    • Creating light-sensitive biosensors for detecting UV radiation in biological systems

For successful optogenetic applications, the lamprey parapinopsin gene would need to be optimized for expression in mammalian cells, potentially including codon optimization, addition of trafficking signals, and fusion to fluorescent reporters for monitoring expression and localization.

What are the key considerations when designing site-directed mutagenesis studies of lamprey parapinopsin?

When designing site-directed mutagenesis studies of lamprey parapinopsin, researchers should consider several critical factors:

  • Functional Domains and Key Residues:

    • The retinal-binding pocket, particularly residues that interact directly with the chromophore

    • The Schiff base linkage site (conserved lysine in transmembrane helix VII)

    • G-protein binding regions, especially the intracellular loops and C-terminus

    • Residues potentially involved in stabilizing the bistable photoproduct

  • Comparative Sequence Analysis:

    • Identify residues that differ between parapinopsin and conventional visual opsins

    • Target residues unique to the PP group that may contribute to bistable photochemistry

    • Consider conserved vs. variable sites across parapinopsin homologs from different species

  • Spectral Tuning Determinants:

    • Focus on residues in the retinal binding pocket that may influence the UV sensitivity

    • Consider residues that may affect the stability and absorption properties of the photoproduct

  • Experimental Readouts:

    • Plan for spectroscopic analysis of mutants to assess changes in absorption maxima

    • Design functional assays to measure G-protein activation efficiency

    • Consider structural stability assessments to ensure mutations don't disrupt protein folding

  • Mutation Types to Consider:

    • Conservative substitutions (maintaining similar physicochemical properties)

    • Non-conservative substitutions to test functional hypotheses

    • Swapping residues with those from related opsins to test their contribution to specific properties

    • Creating chimeric constructs between parapinopsin and other opsins to identify functional domains

  • Potential Target Residues Based on Current Knowledge:

    • Counterion residues that stabilize the protonated Schiff base

    • Hydrophobic residues in the retinal binding pocket that may influence chromophore orientation

    • Residues in transmembrane domains III, VI, and VII that may participate in conformational changes during photoactivation

These considerations will help design targeted mutagenesis strategies to investigate the molecular basis of parapinopsin's unique properties and potentially engineer variants with modified spectral or biochemical characteristics.

What are the current challenges in expressing and purifying sufficient quantities of recombinant lamprey parapinopsin for structural studies?

Several significant challenges exist in producing sufficient quantities of recombinant lamprey parapinopsin for structural studies:

  • Expression System Limitations:

    • Mammalian cell expression systems typically yield relatively low protein quantities compared to bacterial or yeast systems

    • Bacterial expression systems often fail to properly fold membrane proteins like opsins

    • Insect cell systems may provide better yields but require specialized expertise and equipment

  • Protein Stability Issues:

    • Membrane proteins are inherently unstable when removed from their native lipid environment

    • The bistable nature of parapinopsin means it can exist in different conformational states depending on light exposure, complicating purification

    • The chromophore attachment is sensitive to detergent exposure and pH conditions

  • Chromophore Availability:

    • 11-cis-3-dehydro-retinal (retinal 2) is not commercially available and must be synthesized or isolated

    • Proper incorporation of the chromophore during expression is critical for functional studies

    • Light exposure during purification can cause unwanted photoconversion

  • Purification Challenges:

    • Selection of appropriate detergents that maintain protein stability and function

    • Development of purification protocols that preserve the native conformation

    • Removal of contaminating proteins while maintaining sufficient yield

  • Structural Study Requirements:

    • X-ray crystallography requires highly pure, homogeneous, and stable protein samples

    • Cryo-EM studies need sufficient concentration and monodispersity

    • NMR studies require isotope labeling and often higher protein quantities

Potential Solutions:

  • Use of specialized expression systems optimized for membrane proteins, such as certain yeast strains or cell-free systems

  • Addition of stabilizing mutations identified through directed evolution approaches

  • Employment of lipid nanodiscs or other membrane mimetics to maintain a native-like environment

  • Development of fusion constructs with proteins known to enhance expression and stability

  • Careful light management throughout the purification process to maintain homogeneous conformation

These challenges have limited structural studies of most non-visual opsins, including parapinopsin, highlighting the need for innovative approaches in membrane protein production and stabilization.

What are the promising approaches for investigating the in vivo functions of pineal opsins in lampreys?

Several innovative approaches show promise for elucidating the in vivo functions of pineal opsins in lampreys:

  • CRISPR/Cas9 Gene Editing:

    • Developing targeted knockout or knockin models for parapinopsin and related opsins

    • Creating reporter lines with fluorescent proteins under opsin promoters to visualize expression patterns

    • Generating point mutations to test specific hypotheses about spectral tuning or signaling

  • Electrophysiological Approaches:

    • Combining intracellular recording with neurobiotin labeling to correlate physiological responses with cell morphology and opsin expression

    • Using multi-electrode arrays to record from populations of pineal neurons under different wavelengths of light

    • Employing patch-clamp recordings to characterize the detailed electrophysiological properties of identified opsin-expressing cells

  • Advanced Imaging Techniques:

    • Calcium imaging in intact pineal preparations to visualize neural activity patterns in response to different light stimuli

    • Two-photon microscopy to achieve deeper imaging within the pineal organ and brain

    • Super-resolution microscopy to visualize the subcellular localization of different opsins

  • Behavioral Assays:

    • Developing behavioral paradigms to test wavelength discrimination abilities

    • Investigating how pineal photoreception influences locomotor activity, circadian rhythms, or vertical migration

    • Correlating natural light conditions with behavioral outputs in wild lampreys

  • Integrative Circuit Analysis:

    • Tracing neural connections between the pineal, retina, and brain regions using retrograde and anterograde tracers

    • Investigating the functional significance of opsin-expressing cells projecting to the retina

    • Characterizing the synaptic mechanisms through which pineal photoreceptors communicate with ganglion cells

  • Molecular Signaling Studies:

    • Investigating downstream signaling pathways activated by different opsins

    • Characterizing the G-protein coupling specificities of parapinopsin and P-opsin in vivo

    • Identifying target genes regulated by pineal photoreception

These approaches, especially when combined in integrative studies, hold significant potential for advancing our understanding of the complex photoreceptive systems in the lamprey pineal and their evolutionary significance.

How might lamprey parapinopsin research contribute to understanding human non-visual photoreception?

Lamprey parapinopsin research offers several valuable insights that could enhance our understanding of human non-visual photoreception:

  • Evolutionary Conservation of Photoreceptive Mechanisms:

    • By studying one of the most ancient vertebrate lineages, we gain insights into which aspects of photoreception have been conserved across 500+ million years of evolution

    • Identifying fundamental principles of non-visual photoreception that may still operate in mammals despite the loss of direct pineal photosensitivity

  • G-protein Coupled Signaling Pathways:

    • Parapinopsin activates Gi-type G proteins , similar to some non-visual opsins in mammals

    • Understanding these signaling cascades in the simpler lamprey system could inform research on melanopsin and other non-visual opsins in humans

  • Centrifugal Regulation of Retinal Function:

    • The discovery that opsin-expressing brain neurons project to the retina in lampreys suggests potential regulatory mechanisms that might have homologs in mammalian systems

    • This could inspire investigations into whether similar centrifugal pathways modulate human retinal function

  • Color Discrimination Mechanisms:

    • Research on how lampreys achieve wavelength discrimination through separate photoreceptor cells expressing different opsins provides insights into non-image-forming color discrimination

    • This may inform studies on how melanopsin interacts with cone inputs in the human non-visual system

  • Chromophore Regeneration Mechanisms:

    • The bistable nature of parapinopsin, allowing chromophore regeneration through light absorption rather than enzymatic pathways , represents an alternative strategy for maintaining photosensitivity

    • This could inspire development of therapeutic approaches for conditions involving defective chromophore regeneration in humans

  • Molecular Evolution of Opsins:

    • Comparative analysis of parapinopsin and human opsins can identify conserved functional domains and residues

    • Understanding how spectral tuning evolved across vertebrates may inform research on human color vision disorders

While humans lack direct pineal photosensitivity, the fundamental mechanisms of non-visual photoreception in ancient vertebrates like lampreys provide valuable context for understanding the evolutionary origins and basic principles of non-visual light detection systems that continue to operate in humans through melanopsin and potentially other non-visual opsins.

What unexplored aspects of lamprey pineal opsin biochemistry might yield significant insights?

Several unexplored aspects of lamprey pineal opsin biochemistry represent promising avenues for future research:

  • Lipid-Protein Interactions:

    • How specific membrane lipids influence the stability and function of pineal opsins

    • Whether specialized lipid microdomains in ciliary membranes contribute to opsin clustering or signaling efficiency

    • The role of membrane cholesterol in modulating photochemical properties of parapinopsin

  • Post-translational Modifications:

    • Identification of phosphorylation, glycosylation, or other modifications that may regulate parapinopsin activity

    • Whether light-dependent modifications differ between parapinopsin and conventional visual opsins

    • How such modifications might contribute to the unusual photochemical stability of parapinopsin

  • Protein-Protein Interactions:

    • Identification of binding partners beyond G-proteins that may modulate parapinopsin function

    • Whether parapinopsin forms dimers or higher-order oligomers like some other GPCRs

    • Potential interactions between parapinopsin and P-opsin when co-expressed in the same cell or cellular compartment

  • Chromophore-Protein Interactions:

    • Detailed structural basis for the stabilization of both 11-cis and all-trans configurations within the binding pocket

    • Whether water molecules or specific hydrogen bonding networks contribute to the bistable photochemistry

    • How the protein environment tunes the absorption spectrum to achieve UV sensitivity

  • Signaling Kinetics and Termination:

    • Mechanisms and rates of signal termination after photoactivation

    • Whether specialized phosphatases or arrestins regulate parapinopsin signaling

    • How signaling duration is controlled in a bistable pigment that doesn't release its chromophore

  • Subcellular Trafficking and Localization:

    • Mechanisms directing parapinopsin to ciliary membranes

    • Protein turnover rates and degradation pathways

    • Whether light exposure affects subcellular distribution or protein stability

  • Alternative Signaling Pathways:

    • Whether parapinopsin can couple to multiple G-protein subtypes under different conditions

    • Exploration of potential G-protein-independent signaling mechanisms

    • Cross-talk between parapinopsin and P-opsin signaling when co-expressed

These unexplored aspects of lamprey pineal opsin biochemistry could yield significant insights into both fundamental photobiochemistry and the specialized adaptations that allow these ancient photoreceptors to perform their unique functions in non-visual light detection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.