Recombinant Petromyzon marinus Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly specify it when placing your order and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Petromyzon marinus (Sea lamprey)
Target Names
RHO
Target Protein Sequence
MNGTEGENFYIPFSNKTGLARSPFEYPQYYLAEPWKYSVLAAYMFFLILVGFPVNFLTLF VTVQHKKLRTPLNYILLNLAVANLFMVLFGFTLTMYSSMNGYFVFGPTMCNFEGFFATLG GEMSLWSLVVLAIERYIVICKPMGNFRFGSTHAYMGVAFTWFMALSCAAPPLVGWSRYLP EGMQCSCGPDYYTLNPNFNNESFVIYMFLVHFIIPFIVIFFCYGRLLCTVKEAAAAQQES ASTQKAEKEVTRMVVLMVIGFLVCWVPYASVAFYIFTHQGSDFGATFMTVPAFFAKTSAL YNPIIYILMNKQFRNCMITTLCCGKNPLGDEDSGASTSKTEVSSVSTSQVSPA
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species use retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the gene structure of Petromyzon marinus Rhodopsin and how does it compare to other vertebrate rhodopsins?

Petromyzon marinus Rhodopsin (RHO) gene spans 21.2 kb from start to stop codons, making it the longest opsin gene known in vertebrates. Southern analysis suggests that the lamprey genome contains a single rhodopsin gene, unlike some other vertebrates that possess multiple opsin genes . The amino acid sequence deduced from this gene shows 92% similarity with that of the river lamprey rhodopsin, indicating significant conservation within lamprey species .

Interestingly, amino acid substitutions have occurred more frequently in the transmembrane region than in the non-transmembrane region during evolution. This pattern of substitution suggests functional adaptation of the rhodopsin during the last 500 million years of jawless fish evolution . These adaptations likely reflect the specialized visual requirements of lampreys in their ecological niche.

How does lamprey rhodopsin function in the visual system and how does it interact with melanopsin?

In the lamprey visual system, rhodopsin functions primarily in image-forming vision, while melanopsin appears to be the dominant photopigment for non-image-forming functions such as the pupillary light reflex (PLR). This represents a division of labor that differs from the arrangement in mammals, where both photopigments contribute to the PLR .

Studies on the pupillary light reflex in lamprey have revealed that the PLR is most readily evoked by blue light with peak sensitivity at 480 nm, which matches the λmax of expressed lamprey melanopsin . The action spectrum does not correspond to the spectral sensitivity of lamprey rods (522 nm) or cones (590-600 nm), indicating that rhodopsin makes little or no contribution to this reflex .

This functional separation provides valuable insights into the early evolution of vertebrate visual systems. Interestingly, melanopsin-expressing horizontal cells have been observed to connect to rhodopsin-containing short photoreceptor cells in the lamprey retina, suggesting potential modulatory interactions between these two visual pathways despite their functional independence .

What insights does Petromyzon marinus rhodopsin provide into the evolution of vertebrate visual systems?

As a member of the only remaining group of jawless vertebrates (agnathans), the sea lamprey provides a unique window into early vertebrate evolution. The study of Petromyzon marinus rhodopsin reveals several key insights:

First, the presence of a functional rhodopsin in lampreys confirms that the basic mechanism of visual phototransduction via rhodopsin was already established in the common ancestor of all vertebrates approximately 500 million years ago . The conservation of this system across such evolutionary time underscores its fundamental importance.

Second, the unique pattern of amino acid substitutions in lamprey rhodopsin, with more changes in transmembrane regions than non-transmembrane regions, suggests specific functional adaptations during jawless fish evolution . These adaptations may reflect selective pressures related to the lamprey's aquatic environment and predatory lifestyle.

Third, research on lamprey visual pigments has shown that non-image-forming visual functions like the pupillary light reflex emerged early in vertebrate evolution, possibly even before the radiation of present vertebrate lines . This suggests they were already present in the late Cambrian period, making them one of the oldest conserved sensory mechanisms in vertebrates.

How has the functional relationship between rhodopsin and melanopsin evolved in vertebrates?

The relationship between rhodopsin and melanopsin in the lamprey reveals an interesting evolutionary pattern that differs from that seen in other vertebrates.

In lampreys, melanopsin appears to be the primary mediator of the pupillary light reflex (PLR), with rhodopsin making little or no contribution . The PLR in lamprey displays peak sensitivity at 480 nm, matching the absorption spectrum of lamprey melanopsin, while being 100 times less sensitive at 600 nm (the peak sensitivity of lamprey cones) .

This functional separation differs from the arrangement in mammals, where both rhodopsin (through rods) and melanopsin (through intrinsically photosensitive retinal ganglion cells) contribute to the PLR . The lamprey arrangement may represent the ancestral state, with the contribution of rhodopsin to non-image-forming vision being a later evolutionary development in the vertebrate lineage.

Interestingly, while most non-mammalian vertebrates possess multiple melanopsin genes, cyclostomes (including lamprey and hagfish) have only one type of mammalian-like melanopsin gene, similar to mammals . This suggests convergent evolution or the retention of an ancestral state in these distantly related groups.

What expression systems are optimal for producing recombinant Petromyzon marinus rhodopsin?

Several expression systems can be used to produce recombinant Petromyzon marinus rhodopsin, each with distinct advantages and considerations:

  • E. coli Expression System:

    • Provides rapid growth and potentially high yield

    • May require optimization for membrane protein expression

    • Appropriate for producing protein for structural studies or antibody production

  • Yeast Expression System:

    • Offers eukaryotic post-translational modifications

    • Better for functional studies requiring proper protein folding

    • Can be scaled up for larger protein production

  • Baculovirus/Insect Cell Expression System:

    • Provides more authentic post-translational modifications

    • Good for producing functionally active rhodopsin

    • Requires more complex methodology but yields higher quality protein

  • Mammalian Cell Expression System:

    • Offers the most authentic post-translational modifications

    • Optimal for functional studies requiring native protein conformation

    • More expensive and time-consuming but may be necessary for certain applications

The choice of expression system should be guided by the specific research question and downstream applications. For structural studies, E. coli may be sufficient, while functional characterization may require insect or mammalian expression systems.

What purification and storage protocols maximize rhodopsin stability and functionality?

Optimal purification and storage protocols for rhodopsin include:

Purification Strategy:

  • Affinity chromatography using tags such as His-tag, FLAG-tag, or Avi-tag (biotinylated) depending on downstream applications

  • Detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM)

  • Multi-step purification combining affinity chromatography with size exclusion chromatography for highest purity

Buffer Composition:

  • Tris-based buffer with 50% glycerol for stabilization

  • Inclusion of reducing agents to prevent oxidation of cysteine residues

  • Optimized pH (typically 6.5-7.5) to maintain protein stability

Storage Conditions:

  • Store at -20°C or -80°C for extended storage

  • Aliquot to avoid repeated freeze-thaw cycles, which can cause protein denaturation

  • Store working aliquots at 4°C for up to one week

  • Protect from light to prevent photoactivation and subsequent conformational changes

Critical Considerations:

  • All handling should be done under dim red light to prevent unintended photoactivation

  • Maintain detergent concentration above critical micelle concentration throughout purification and storage

  • Include protease inhibitors to prevent degradation

Following these protocols helps maintain the structural integrity and functional properties of recombinant rhodopsin for experimental use.

What spectroscopic methods are most effective for characterizing lamprey rhodopsin properties?

Several spectroscopic techniques are particularly valuable for characterizing Petromyzon marinus rhodopsin:

  • UV-Visible Absorption Spectroscopy:

    • Primary method for determining spectral properties and λmax

    • Allows monitoring of photointermediates following light activation

    • Can be used to assess chromophore binding and regeneration kinetics

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about secondary structure content

    • Useful for confirming proper protein folding

    • Can detect structural changes upon photoactivation

  • Fluorescence Spectroscopy:

    • Can monitor tryptophan fluorescence as a probe of tertiary structure

    • Useful for studying conformational changes during activation

    • Can be applied in FRET studies to measure distances between labeled sites

  • Resonance Raman Spectroscopy:

    • Provides detailed information about the chromophore and its environment

    • Can distinguish between different photointermediates

When combined, these methods provide complementary information about the structural, spectral, and functional properties of lamprey rhodopsin, enabling comprehensive characterization of this important visual pigment.

How can calcium mobilization assays be designed to study lamprey rhodopsin function?

Calcium mobilization assays represent a powerful approach for studying lamprey rhodopsin function. Research has shown that recombinant lamprey melanopsin causes light-dependent increases in calcium ion concentration in cultured cells, suggesting similar assays could be applied to rhodopsin .

Assay Design Considerations:

  • Cell System Selection:

    • Choose cell lines with low endogenous rhodopsin expression (e.g., HEK293, CHO)

    • Co-express necessary signaling components (G proteins, effector enzymes)

    • Ensure cells express calcium-sensitive indicators

  • Calcium Indicator Options:

    • Chemical indicators (Fura-2, Fluo-4) for rapid implementation

    • Genetically encoded indicators (GCaMP) for targeted expression and long-term imaging

    • Bioluminescent indicators (aequorin) for low background applications

  • Experimental Setup:

    • Use plate reader formats for high-throughput screening

    • For detailed kinetic studies, employ fluorescence microscopy with single-cell resolution

    • Include appropriate controls (dark conditions, wavelength controls)

  • Data Analysis:

    • Normalize responses to baseline and maximum signals

    • Calculate dose-response relationships for different wavelengths

    • Determine activation and deactivation kinetics

This approach enables functional characterization of lamprey rhodopsin and comparison with other visual pigments, providing insights into the evolutionary conservation of phototransduction mechanisms.

What techniques are available for studying the interaction between lamprey rhodopsin and other retinal proteins?

Several techniques can be employed to study the interactions between lamprey rhodopsin and other retinal proteins:

  • Co-immunoprecipitation:

    • Precipitate rhodopsin using specific antibodies and identify interacting partners

    • Can be combined with mass spectrometry for unbiased identification

    • Requires development of specific antibodies against lamprey rhodopsin

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusion proteins to biotinylate proximal proteins

    • Allows identification of proteins in the vicinity of rhodopsin in vivo

    • Can capture transient interactions missed by traditional methods

  • Fluorescence Microscopy:

    • Immunohistochemistry to visualize co-localization of rhodopsin with other proteins

    • Particularly valuable given the finding that melanopsin-expressing horizontal cells connect to rhodopsin-containing photoreceptor cells in lamprey

    • FRET microscopy to detect direct protein-protein interactions

  • Electrophysiological Methods:

    • Patch-clamp recordings to study functional coupling between rhodopsin-expressing cells and other retinal neurons

    • Multielectrode arrays to record network responses

These techniques can reveal how lamprey rhodopsin interacts with other components of the visual system, providing insights into the evolution of vertebrate phototransduction networks.

How can site-directed mutagenesis be used to investigate the spectral tuning of lamprey rhodopsin?

Site-directed mutagenesis represents a powerful approach for investigating the molecular basis of spectral tuning in lamprey rhodopsin:

  • Target Selection Strategy:

    • Focus on residues in the transmembrane domains, particularly those facing the retinal binding pocket

    • Target positions that show differences between lamprey and other vertebrates

    • Include residues that show substitutions between marine and river lamprey rhodopsins

  • Key Experimental Approaches:

    • Generate single and multiple amino acid substitutions using standard molecular biology techniques

    • Express mutant proteins in appropriate cell systems

    • Characterize spectral properties using UV-visible absorption spectroscopy

    • Assess functional consequences using G-protein activation or calcium mobilization assays

  • Data Analysis Framework:

    • Correlate spectral shifts with specific amino acid substitutions

    • Develop structure-function models based on homology modeling

    • Compare findings with known spectral tuning mechanisms in other vertebrate rhodopsins

  • Evolutionary Context Considerations:

    • The observation that amino acid substitutions occurred more often in the transmembrane region than in non-transmembrane regions during lamprey evolution suggests potential adaptations in spectral tuning

    • Comparing marine lamprey rhodopsin with river lamprey rhodopsin (92% sequence similarity) can reveal adaptations to different aquatic environments

This approach can provide fundamental insights into the molecular determinants of spectral sensitivity in one of the oldest vertebrate visual pigments, enhancing our understanding of visual evolution.

What are common problems in rhodopsin functional assays and how can they be resolved?

Researchers working with lamprey rhodopsin may encounter several technical challenges in functional assays:

  • Incomplete Chromophore Regeneration:

    • Problem: Poor or variable functional responses due to incomplete incorporation of 11-cis-retinal

    • Solution: Optimize chromophore:protein ratio, incubation time, and temperature; verify regeneration by absorption spectroscopy before functional assays

  • Spontaneous Activation:

    • Problem: High background activity in the absence of light stimulation

    • Solution: Strictly control light exposure using dim red lighting; include dark controls; verify protein stability by thermal denaturation assays

  • Variable Expression Levels:

    • Problem: Inconsistent functional responses due to variable protein expression

    • Solution: Quantify protein expression by Western blotting or fluorescence tagging; normalize functional responses to expression levels

  • Photobleaching During Experiments:

    • Problem: Decreasing responses during repeated light stimulation

    • Solution: Minimize light exposure; include fresh 11-cis-retinal in the assay buffer; use regeneration intervals between stimulations

  • Signal Detection Limitations:

    • Problem: Weak signals that are difficult to distinguish from background

    • Solution: Optimize signal amplification methods; use more sensitive detection systems; consider signal averaging techniques

These troubleshooting approaches can significantly improve the reliability and reproducibility of functional assays for lamprey rhodopsin.

What controls are essential when studying the spectral properties of recombinant lamprey rhodopsin?

When studying the spectral properties of recombinant Petromyzon marinus rhodopsin, several essential controls should be included:

  • Baseline Controls:

    • Buffer-only samples to establish spectroscopic baseline

    • Empty vector-transfected cells to control for non-specific absorbance

    • Dark-adapted samples to establish the ground state spectrum

  • Protein Quality Controls:

    • SDS-PAGE and Western blotting to confirm protein size and purity (>85% purity recommended)

    • Chromophore binding assays to verify functional protein

    • Thermal stability measurements to ensure proper folding

  • Spectral Authentication Controls:

    • Wavelength scans before and after photobleaching

    • Comparison of spectral properties in different detergents

    • pH dependence to confirm proper protonation of the Schiff base

  • Comparative Controls:

    • Well-characterized rhodopsins from other species as reference standards

    • Comparison with native tissue samples where available

    • Mutant versions with known spectral shifts

  • Technical Controls:

    • Multiple independent protein preparations to assess batch-to-batch variability

    • Temperature-controlled measurements to account for thermal effects

    • Measurements at multiple protein concentrations to verify linearity

Implementing these controls ensures that the observed spectral properties accurately reflect the intrinsic characteristics of lamprey rhodopsin rather than artifacts or contaminants.

How can researchers verify the structural integrity of recombinant lamprey rhodopsin?

Verifying the structural integrity of recombinant Petromyzon marinus rhodopsin is critical for ensuring reliable experimental results. Several complementary approaches can be employed:

By combining these approaches, researchers can comprehensively verify that their recombinant lamprey rhodopsin maintains its native structural characteristics and functional properties, ensuring the validity of subsequent experimental findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.