Recombinant Petrotoga mobilis ATP-dependent zinc metalloprotease FtsH 1 (ftsH1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2501888
Source
in vitro E.coli expression system
Synonyms
ftsH1; Pmob_0453; ATP-dependent zinc metalloprotease FtsH 1
Quick Inquiry

Description

Introduction to Recombinant Petrotoga mobilis ATP-dependent Zinc Metalloprotease FtsH 1 (ftsH1)

Recombinant Petrotoga mobilis ATP-dependent zinc metalloprotease FtsH 1 (ftsH1) is a protein derived from the thermophilic bacterium Petrotoga mobilis. This enzyme belongs to the AAA+ family of membrane-bound metalloproteases, which are widely conserved across bacteria, plants, and animals . FtsH proteases are known for their role in protein quality control, particularly in the degradation of damaged or misfolded proteins .

Biochemical Functions and Pathways

FtsH proteases, including the ftsH1 variant, are ATP-dependent zinc metalloproteases that play crucial roles in the degradation of membrane and cytoplasmic proteins. They are involved in various cellular processes, including protein quality control, stress responses, and the regulation of protein turnover . In bacteria, FtsH is essential for maintaining cellular homeostasis by degrading damaged or aberrant proteins .

Biochemical Functions of FtsH Proteases

  • Protein Degradation: FtsH proteases are responsible for the degradation of membrane proteins, which is crucial for maintaining membrane integrity and function .

  • Quality Control: They ensure the removal of misfolded or damaged proteins, preventing their accumulation and potential toxicity .

  • Stress Response: FtsH proteins are involved in stress responses, helping cells cope with environmental stresses by regulating protein levels .

Research Applications and Implications

Recombinant Petrotoga mobilis ATP-dependent zinc metalloprotease FtsH 1 (ftsH1) is used in various research applications, including studies on protein quality control, stress responses, and the development of novel therapeutic strategies. Understanding the mechanisms of FtsH proteases can provide insights into cellular homeostasis and disease prevention.

Potential Research Directions

  • Protein Quality Control: Investigating how FtsH1 regulates protein turnover and maintains cellular homeostasis.

  • Stress Response Mechanisms: Studying the role of FtsH1 in stress responses and its potential as a therapeutic target.

  • Biotechnological Applications: Exploring the use of recombinant FtsH1 in biotechnology for protein degradation and quality control.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsH1; Pmob_0453; ATP-dependent zinc metalloprotease FtsH 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-653
Protein Length
full length protein
Species
Petrotoga mobilis (strain DSM 10674 / SJ95)
Target Names
ftsH1
Target Protein Sequence
MPENKNDKENKNDKENKNTKEEKKKVKFSNIIWVYIIFAVFFIGALISLNWENNPIISYS EMLSLINDGQVESMKINQNGNVEILSKDGTTYESFSPALVIDKQYVNSLIQKGIKVEYVE SVGTKWWFGLLINIIPIVVMVLFFFWLYRSASAGARSSMNFGKSGAKKYEPIGEKVTFKD VAGIDEVLDEIEDIVKFLKNPQEFQELGARMPKGTLLVGPPGTGKTLTARAIAGEADVPF YYASGSDFVELFVGVGASRVRDLFKTAKENAPAIIFIDELDAVGRQRGAGLGGGNDEREQ TLNALLVELDGFDTSTGVVVMAATNRPDVLDKALLRPGRFDKKIMVGPPDVKGREEILKI HTRKKKIAPDVDLKLLAKRTPGFVGADLENLVNEAALIASRKKKNQVEMSDFEEAIDRVL TGPSKKYRIISDKEKKILSYHELGHAVLAYLLPNTDPVYKITIIPRGAGSLGSTLQIPEK DKYLIKKSEILDRIVVALGGRASEKLVFNFATTGAKDDLRKATDYAKSMIYRLGMSKRMG PVYWEGEEEEIFLGSELTKQRNYSEETAKELDVEVKKIINSMYDKALELLKQNRERLDLL ASYIFKNETIYGEEFKKLMSKDLEELKEYIGGEKEINEFLKIDVVNHVNYQPV
Uniprot No.
A9BFL9

Target Background

Function

This recombinant Petrotoga mobilis ATP-dependent zinc metalloprotease FtsH1 functions as a processive, ATP-dependent zinc metallopeptidase targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.

Database Links

KEGG: pmo:Pmob_0453

STRING: 403833.Pmob_0453

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.