Recombinant Petrotoga mobilis Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipment is required, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; Pmob_1116; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-472
Protein Length
full length protein
Species
Petrotoga mobilis (strain DSM 10674 / SJ95)
Target Names
secD
Target Protein Sequence
MRNRRIRILFTVIVFVFALLGLILPLSGNVNDISILRFFPNINLGLDIQGGVLLEYSFDV PEGVNTSEVVDNVITVLRRRMDNAGYTEAIVSEVVSGGESRVRVEIPGISDTQRAEELIG SKGKLYFAEVLEVVESTTTPEITRNRTIQINGEEIEMYSYVKDSNNPNLWYRVKNVFEFG DAPFQITGLDVTDAVASLNSQGAGFVVNLNFSNEGRQKFELATANLVNERIAIILDDEVI IAPVVRERISQGRAEISGIESMEEAQNIAVLIKSGNLPVDLVKYQERTLGPTLGRDIVTT IINAGIIGLIIVMIYMIIFYRWMGVIADIALIYNTFLLMGILSWTGAILTLPGIAGIILT FGTTVDGNIIIYERIKEELRIGRPPLTAVKFGFNKVFSTIFDANITTILAGLVLFFVTSG SIRGFAVTLIIGVLGAMFTNLVVSRLLLESTSHFLKPEKYVKGIVVEKGGTK
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Petrotoga mobilis Protein translocase subunit SecD?

Recombinant Petrotoga mobilis Protein translocase subunit SecD (secD) is a bacterial membrane protein component of the Sec-translocase system that facilitates protein secretion across the cytoplasmic membrane. It originates from Petrotoga mobilis strain DSM 10674/SJ95, a thermophilic bacterium. The protein has a UniProt accession number of A9BG79, with an expression region spanning amino acids 1-472 of the full-length protein . As part of the SecDF complex, SecD plays an essential role in the later stages of protein translocation, where it is believed to use the proton motive force (PMF) to pull preproteins into the periplasmic space, thus completing the translocation process . The protein contains multiple transmembrane domains and periplasmic loops that are critical for its function in protein secretion.

How does SecD function within the bacterial protein secretion pathway?

SecD functions as part of the heterodimeric SecDF complex in the bacterial Sec-translocase system. The protein secretion pathway begins when nascent secretory proteins with signal sequences interact with the trigger factor (TF), followed by the chaperone SecB, which maintains the preprotein in an unfolded conformation . The motor protein SecA then binds to the preprotein and directs it to the SecYEG channel, using ATP hydrolysis to drive translocation through the membrane . SecDF comes into play during the later stages of translocation, where it is proposed to use the proton motive force (PMF) to pull the partially translocated protein from the SecYEG channel into the periplasm . Without SecDF, the efficiency of protein translocation decreases significantly, particularly for proteins with complex folding requirements. The SecD subunit specifically contributes to the conformational changes necessary for this "pulling" mechanism.

What is the recommended storage and handling protocol for recombinant SecD protein?

For optimal stability and activity, recombinant Petrotoga mobilis SecD protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein . The recommended storage temperature is -20°C for regular use, but for extended storage, the protein should be kept at -20°C to -80°C to maintain its structural integrity and functional properties . Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity . For ongoing experiments, working aliquots may be stored at 4°C for up to one week without significant degradation . When handling the protein, it's advisable to use low-protein binding tubes and pipette tips to minimize protein loss through adsorption to surfaces. The protein should be thawed gently on ice when removed from frozen storage and centrifuged briefly to collect all the solution at the bottom of the tube before use.

How does the mechanism of SecD differ from other components of the Sec translocase system?

SecD operates distinctly from other Sec translocase components by focusing on the later stages of translocation rather than the initial or middle phases. While SecA functions as an ATP-dependent motor protein that threads the unfolded polypeptide through the SecYEG channel, SecD (as part of the SecDF complex) utilizes the proton motive force (PMF) rather than ATP hydrolysis for its energy source . This fundamental difference in energy coupling represents a transition in the translocation process from ATP-dependent pushing to PMF-dependent pulling mechanisms. SecYEG forms the protein-conducting channel that provides a pathway across the membrane, with the channel opening regulated by SecA's conformational changes . In contrast, SecD does not form a channel but instead interacts with the emerging polypeptide on the periplasmic side of the membrane. The periplasmic domains of SecD likely undergo large conformational changes coupled to proton movement, allowing it to bind the translocating protein and pull it further into the periplasm. This pulling action complements SecA's pushing function, potentially resolving stalled translocation events and ensuring complete translocation.

What is known about the force generation mechanism of the Sec translocase system, and how might SecD contribute?

ComponentEnergy SourceForce DirectionEstimated ForceMechanism
SecAATPPushing (cytoplasmic to periplasmic)≥10 piconewtonsPower stroke via two-helix finger movement
SecDF (including SecD)PMFPulling (periplasmic side)Not directly measuredConformational changes coupled to proton movement
Combined Sec systemATP + PMFBidirectional>10 piconewtonsCoordinated push-pull action

How do post-translational modifications affect SecD function, and what methodologies can detect these modifications?

Post-translational modifications (PTMs) of SecD can significantly alter its structural dynamics and functional properties, though specific PTMs in Petrotoga mobilis SecD have not been extensively characterized in the provided research. Based on studies of SecD homologs in other bacteria, potential modifications include phosphorylation of serine, threonine, or tyrosine residues, which could regulate SecD's conformational changes or interactions with other Sec components. To investigate these modifications, researchers can employ a combination of mass spectrometry-based proteomics approaches. Specifically, phosphoproteomic analysis using titanium dioxide (TiO₂) enrichment followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify phosphorylation sites. For other PTMs like methylation or acetylation, immunoprecipitation with modification-specific antibodies followed by MS analysis is effective. Functional impacts of identified PTMs can be assessed by site-directed mutagenesis, replacing modified residues with non-modifiable amino acids (e.g., serine to alanine) or phosphomimetic residues (e.g., serine to aspartate), followed by in vitro translocation assays to compare activity. Additionally, differential PTM patterns under various growth conditions can provide insights into regulatory mechanisms, requiring comparative PTM profiling of SecD isolated from bacteria grown under different physiological states.

What protein-protein interactions does SecD form within the SecDF complex and with other components of the translocation machinery?

SecD forms several critical protein-protein interactions that facilitate its function in protein translocation. The most well-characterized interaction is with SecF, forming the SecDF heterodimeric complex that functions as a single unit in the translocation process . This interaction involves multiple contact points across both the transmembrane and periplasmic domains of both proteins. Additionally, SecDF associates with the SecYEG channel complex, creating a larger supercomplex that coordinates the entire translocation process. While direct interactions between SecD and SecA have not been definitively established, indirect communication likely occurs through conformational changes in the SecYEG channel. SecD also interacts transiently with the translocating polypeptide substrates, particularly through its periplasmic domains. These substrate interactions are dynamic and depend on the translocation state of the preprotein.

To investigate these interactions, researchers can employ:

  • Chemical cross-linking coupled with mass spectrometry (XL-MS) to identify specific residues involved in protein-protein contacts

  • Co-immunoprecipitation followed by Western blotting to verify interactions in vivo

  • Bacterial two-hybrid or yeast two-hybrid assays to screen for novel interaction partners

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding affinities

  • Cryo-electron microscopy to visualize the complete translocon complex architecture

Mutations at interaction interfaces can significantly disrupt SecD function, leading to protein secretion defects and potentially bacterial growth impairment under certain conditions.

What are the optimal conditions for expressing and purifying functional recombinant Petrotoga mobilis SecD?

Expressing and purifying functional Petrotoga mobilis SecD requires careful optimization due to its hydrophobic transmembrane domains. For expression, an E. coli-based system using BL21(DE3) or C43(DE3) strains (specialized for membrane proteins) is recommended. The gene should be cloned into a vector with an inducible promoter (such as pET series) and fused to an affinity tag (6xHis or Strep-tag) for purification . Expression conditions should be optimized at lower temperatures (16-25°C) following induction with reduced IPTG concentrations (0.1-0.5 mM) to prevent inclusion body formation. Media supplements like glucose (0.5-1%) and specialized media like MagicMedia can improve expression yields .

For purification, a multi-step protocol is necessary:

  • Membrane fraction isolation via ultracentrifugation following cell lysis

  • Membrane protein solubilization using mild detergents (DDM, LDAO, or C12E8) at concentrations just above their critical micelle concentration

  • Affinity chromatography using Ni-NTA resin for His-tagged proteins

  • Size exclusion chromatography to remove aggregates and improve purity

  • Optional ion exchange chromatography for further purification

Throughout purification, detergent concentration must be maintained above CMC to prevent protein aggregation. The purified protein should be concentrated to 1-5 mg/mL in a buffer containing Tris-HCl (pH 8.0), NaCl (100-300 mM), glycerol (10-50%), and detergent at 1-2x CMC . Protein functionality can be verified using ATPase activity assays (in combination with SecA) or in vitro translocation assays with model substrate proteins.

How can researchers design experiments to investigate the role of SecD in protein translocation kinetics?

To investigate SecD's role in protein translocation kinetics, researchers should design experiments that allow real-time monitoring of translocation events with and without functional SecD. A comprehensive experimental approach would include:

  • In vitro reconstitution system:

    • Purify individual components (SecA, SecYEG, SecDF) and reconstitute into liposomes

    • Create variants with SecD mutations or SecD deletion

    • Compare translocation efficiency using fluorescently labeled substrate proteins

  • Real-time kinetic measurements:

    • Employ continuous real-time translocation assays using FRET-based reporters

    • Monitor protease protection assays with time-course sampling to track translocation progress

    • Use stopped-flow fluorescence to capture rapid kinetic phases

  • Single-molecule approaches:

    • Apply optical tweezers to measure force generation during translocation as demonstrated for SecA

    • Use single-molecule FRET to track conformational changes during translocation

    • Employ nanodiscs containing individual translocons for controlled experiments

  • Substrate protein engineering:

    • Create substrate proteins with tunable stability domains as translocation barriers

    • Design substrate proteins with fluorescent markers at strategic positions

    • Incorporate photocrosslinkable amino acids to capture transient interactions with SecD

Analysis should focus on extracting rate constants for different steps, particularly comparing the kinetics of early versus late stages of translocation to isolate SecD's contribution. The experimental design should incorporate controls for energy source depletion (ATP, PMF) and temperature effects, especially since Petrotoga mobilis is a thermophilic organism and its proteins may have temperature-dependent activity profiles. Statistical analysis using ANOVA with post-hoc tests should be applied to determine significant differences in translocation kinetics under various conditions .

What methodologies are most effective for studying the structure-function relationship of SecD?

Studying the structure-function relationship of SecD requires an integrated approach combining structural analysis with functional assays. The most effective methodologies include:

  • High-resolution structural determination:

    • X-ray crystallography of SecD alone or in complex with SecF (challenging for membrane proteins)

    • Cryo-electron microscopy (cryo-EM) of the SecDF complex, potentially capturing different conformational states

    • NMR spectroscopy for studying dynamic regions or isolated domains

    • Molecular dynamics simulations to predict conformational changes and functional motions

  • Structure-guided mutagenesis:

    • Alanine-scanning mutagenesis of conserved residues and domains

    • Site-directed mutagenesis targeting predicted functional sites:

      • Periplasmic loops involved in substrate binding

      • Transmembrane residues potentially involved in proton translocation

      • Interface residues mediating SecF interactions

    • Creation of chimeric proteins with domains from other species to identify species-specific functions

  • Functional assessment techniques:

    • In vitro translocation assays using purified components and model substrates

    • ATPase activity measurements to assess coupling with SecA

    • Proton transport assays to evaluate PMF utilization

    • Protein-protein interaction studies using SPR, ITC, or FRET

    • In vivo complementation assays in SecD-depleted bacterial strains

  • Conformational dynamics studies:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes

    • Distance measurements using double electron-electron resonance (DEER) spectroscopy

    • Time-resolved fluorescence measurements with strategically placed fluorophores

By systematically correlating structural features with functional outcomes, researchers can map the critical elements of SecD that contribute to its role in protein translocation. Particular attention should be paid to regions showing high conservation across species, as these often indicate functionally important domains.

How should researchers interpret contradictory findings regarding SecD function in different bacterial species?

When encountering contradictory findings regarding SecD function across different bacterial species, researchers should systematically analyze several factors that could explain these discrepancies. First, consider evolutionary divergence - SecD proteins from thermophilic bacteria like Petrotoga mobilis may have adapted to function optimally at higher temperatures, potentially utilizing different mechanisms than mesophilic counterparts . Second, evaluate methodological differences between studies, including protein purification techniques, reconstitution systems, and assay conditions, which can significantly impact results. Third, examine the genomic context of secD in different species, as operon structures and regulatory elements can influence expression patterns and functional coupling with other components.

To systematically address contradictions, researchers should:

  • Perform comparative sequence and structural analyses to identify conserved versus variable regions across species

  • Directly compare proteins from different species under identical experimental conditions

  • Create chimeric proteins swapping domains between species to identify regions responsible for functional differences

  • Consider the physiological context - SecD may play different roles depending on the secretion demands of the organism

  • Evaluate potential compensatory mechanisms that might mask SecD defects in certain species

What statistical approaches are most appropriate for analyzing SecD-dependent translocation data?

Analyzing SecD-dependent translocation data requires robust statistical approaches tailored to the experimental design and data characteristics. For kinetic translocation assays comparing wild-type versus SecD-mutant or SecD-depleted conditions, repeated measures ANOVA is appropriate when assessing time-course data . This should be followed by post-hoc tests such as Bonferroni to identify significant time points while controlling for multiple comparisons . For single-molecule force measurements, bootstrapping methods can generate confidence intervals for force estimates without assuming normal distributions. When analyzing complex datasets involving multiple variables (e.g., temperature, substrate properties, SecD variants), multivariate regression models or principal component analysis can identify key factors influencing translocation efficiency.

For experiments measuring the proportion of translocated proteins, appropriate data transformations (often arcsine for percentage data) should be applied before parametric testing. Researchers should report effect sizes alongside p-values to indicate biological significance beyond statistical significance. Power analysis should be conducted a priori to determine appropriate sample sizes, particularly for experiments with subtle phenotypes. For all statistical analyses, researchers should verify that their data meet the assumptions of their chosen tests, including normality (using Shapiro-Wilk test) and homogeneity of variance (using Levene's test). When assumptions are violated, non-parametric alternatives such as Kruskal-Wallis or permutation tests should be employed. Bayesian statistical approaches can be particularly valuable when incorporating prior knowledge about SecD function into new analyses.

How can researchers effectively integrate structural, biochemical, and genetic data to develop comprehensive models of SecD function?

Developing comprehensive models of SecD function requires the integration of diverse data types through several methodological approaches. Researchers should begin by creating a structural framework based on available crystal structures, cryo-EM maps, or homology models of SecD . This structural foundation can then be annotated with biochemical data, mapping functional residues identified through mutagenesis studies onto the structure. Genetic data, including suppressor mutations and evolutionary conservation patterns, should be incorporated to identify networks of functionally related residues. Molecular dynamics simulations can bridge static structural snapshots with dynamic functional states, generating testable hypotheses about conformational changes during the translocation cycle .

Integration can be formalized through:

  • Systems biology approaches using protein interaction networks that place SecD within the broader cellular context

  • Mathematical modeling of translocation kinetics, incorporating rate constants derived from biochemical experiments

  • Machine learning algorithms to identify patterns in large datasets that might reveal new functional insights

  • Visualization tools that allow simultaneous representation of multiple data types on structural models

Cross-validation between different experimental approaches is essential - for example, predictions from molecular dynamics should be tested through targeted mutagenesis and functional assays. Throughout the integration process, researchers should maintain awareness of the limitations of each data type and avoid overinterpreting results. The resulting models should make explicit, testable predictions about SecD function that can guide future experiments. As new data becomes available, models should be iteratively refined rather than discarded, creating a continuously evolving understanding of SecD's role in protein translocation.

What are the most promising approaches for developing inhibitors or modulators of SecD function for basic research applications?

Developing inhibitors or modulators of SecD function would provide valuable tools for basic research into protein translocation mechanisms. The most promising approaches include:

  • Structure-based drug design:

    • Virtual screening of compound libraries targeting identified binding pockets in SecD

    • Fragment-based drug discovery focusing on the periplasmic domains

    • Rational design of peptidomimetics that compete with translocating substrates

  • High-throughput screening approaches:

    • Development of FRET-based assays to monitor SecD conformational changes

    • Adaptation of in vitro translocation assays for microplate format

    • Phenotypic screens in bacterial strains with SecD reporters

  • Peptide-based inhibitors:

    • Design of stapled peptides mimicking SecD interaction interfaces

    • Phage display to identify peptides that selectively bind SecD

    • Cell-penetrating peptides fused to SecD-binding motifs

  • Allosteric modulators:

    • Compounds targeting the interface between SecD and SecF

    • Molecules that affect proton translocation without blocking the substrate binding site

    • Small molecules that stabilize specific conformational states

  • Genetic tools:

    • Development of SecD variants with engineered ligand-binding domains

    • Optogenetic control of SecD function using light-sensitive domains

    • Degron-based approaches for rapid depletion of SecD protein

For validation and characterization of developed tools, researchers should employ multiple orthogonal assays including in vitro translocation, bacterial growth assays under secretion stress, and direct binding measurements. The most useful research tools would allow temporal control over inhibition and show specificity for SecD over other components of the Sec system. The ideal modulator would also display species selectivity, allowing comparative studies between different bacterial SecD proteins.

What potential roles might SecD play in bacterial stress responses and adaptation to environmental changes?

SecD likely plays significant roles in bacterial stress responses and environmental adaptation through its function in protein secretion. During temperature stress, particularly for thermophiles like Petrotoga mobilis, SecD may undergo conformational adjustments to maintain optimal translocation efficiency as membrane fluidity changes . Under oxidative stress, the efficient translocation of detoxifying enzymes and repair proteins to the periplasm becomes critical for survival, potentially increasing the importance of SecD function. Nutrient limitation may trigger changes in SecD expression or activity to prioritize the secretion of nutrient acquisition systems.

Future research should investigate:

  • Transcriptional and translational regulation of secD under various stress conditions

  • Post-translational modifications of SecD as rapid response mechanisms

  • Changes in SecD-substrate specificity during stress adaptation

  • Potential moonlighting functions of SecD beyond its role in protein translocation

  • Co-evolution of SecD with stress-responsive secreted proteins across bacterial species

Experimental approaches should include global transcriptomics and proteomics under stress conditions, coupled with targeted analysis of the Sec translocase components. ComparatIve studies between extremophiles like Petrotoga mobilis and mesophilic bacteria could reveal adaptation mechanisms in the secretion machinery. Understanding these adaptive roles could provide insights into bacterial survival mechanisms and potentially reveal new targets for antimicrobial development.

How might advances in cryo-electron microscopy and other structural techniques transform our understanding of SecD function?

Recent advances in cryo-electron microscopy (cryo-EM) and other structural techniques stand to revolutionize our understanding of SecD function by providing unprecedented insights into its structure, dynamics, and interactions. Cryo-EM has undergone a "resolution revolution," now routinely achieving near-atomic resolution for membrane protein complexes. This technology could capture SecD in multiple conformational states during the translocation cycle, revealing the structural basis for its PMF-dependent activity . The ability to visualize the complete SecYEG-SecDF-SecA complex would illuminate how these components coordinate their activities during translocation.

Emerging structural techniques with transformative potential include:

  • Time-resolved cryo-EM to capture short-lived translocation intermediates

  • Cryo-electron tomography of SecD in its native membrane environment

  • Micro-electron diffraction (microED) for crystallographic analysis of small SecD domains

  • Integrative structural biology approaches combining multiple techniques

  • In-cell structural determination using techniques like FRET-based nanosensors

These structural insights would address fundamental questions about SecD, including:

  • The structural basis for PMF coupling to protein movement

  • Conformational changes during the translocation cycle

  • Substrate recognition and binding mechanisms

  • Species-specific structural adaptations

The combination of high-resolution structures with functional assays and computational modeling would provide a comprehensive understanding of how SecD contributes to protein secretion. This knowledge could inform the development of new antimicrobials targeting the Sec system and advance protein engineering efforts for biotechnological applications.

What are the key takeaways for researchers beginning to work with Recombinant Petrotoga mobilis Protein translocase subunit SecD?

Researchers beginning work with Recombinant Petrotoga mobilis Protein translocase subunit SecD should recognize several key considerations. First, this protein functions as part of a larger complex (SecDF) that plays a critical role in the final stages of bacterial protein translocation . Unlike the ATP-dependent SecA motor, SecD utilizes the proton motive force to drive its activity, representing a distinct energy-coupling mechanism within the Sec system . The protein contains multiple transmembrane domains and undergoes conformational changes essential to its function in "pulling" translocating proteins into the periplasm.

From a practical perspective, researchers should be aware that SecD is a challenging membrane protein requiring optimized expression and purification protocols. The recombinant protein should be stored in 50% glycerol at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided to maintain protein stability and function . For functional studies, SecD should ideally be investigated in conjunction with its partner SecF and the other components of the Sec system, as isolated SecD may not fully recapitulate its native activity.

Researchers should approach SecD with an interdisciplinary mindset, combining structural, biochemical, and genetic approaches to develop a comprehensive understanding of its function. The challenges of working with this membrane protein are balanced by its significance in a fundamental cellular process and the potential for new insights into bacterial protein secretion mechanisms.

How can the study of SecD from Petrotoga mobilis contribute to our broader understanding of protein translocation systems across different domains of life?

Studying SecD from the thermophilic bacterium Petrotoga mobilis offers unique opportunities to advance our understanding of protein translocation systems across life domains. As a thermophile, P. mobilis has evolved proteins with enhanced stability, potentially providing more robust components for structural and functional studies . Comparing SecD from this thermophile with mesophilic homologs can reveal fundamental principles of how protein translocation machinery adapts to extreme environments while maintaining essential functions.

The bacterial Sec system shares evolutionary origins with counterparts in archaea and eukaryotes, serving as a model for more complex translocation systems. Insights from P. mobilis SecD could illuminate conserved mechanisms that have been maintained throughout evolution, such as the use of energy coupling (ATP hydrolysis or PMF) to drive protein movement across membranes . The force generation aspects of SecA and SecDF in bacteria may have parallels in mitochondrial and chloroplast protein import, as well as in the endoplasmic reticulum translocon.

Additionally, P. mobilis SecD could serve as a simplified system for understanding how translocation components coordinate their activities during protein secretion. The principles elucidated might apply to more complex systems like the eukaryotic Sec61 complex and associated factors. Evolutionary analysis comparing SecD across different bacterial phyla, archaea, and eukaryotic organelles could reveal diversification patterns that reflect adaptation to different cellular environments and secretion requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.