Recombinant Petunia hybrida Bidirectional sugar transporter NEC1 (NEC1)

Shipped with Ice Packs
In Stock

Description

Introduction to NEC1

Nectaries are specialized plant organs responsible for nectar production, serving as attractants for pollinators in flowering plants. These organs are typically located inside flowers (floral nectaries) or outside them (extrafloral nectaries) and are attached to various floral structures such as the base of filaments, ovaries, or other floral organs . Nectar primarily consists of sugars, predominantly sucrose, glucose, and fructose, though small amounts of other substances may be present .

The molecular mechanisms governing nectary development and nectar secretion have remained poorly understood until recently. NEC1 represents a significant breakthrough in this field, as it was identified as a novel gene predominantly expressed in the nectaries of Petunia hybrida . Cloned using differential display RT-PCR technique, NEC1 encodes a bidirectional sugar transporter that facilitates the movement of sugars across cell membranes and plays critical roles in nectar production and secretion .

Protein Structure

The NEC1 protein consists of 265 amino acids with a molecular weight of approximately 30,256 Daltons . Structural analysis reveals that NEC1 possesses seven hydrophobic transmembrane segments (TMSs), characteristic of membrane transport proteins . The secondary structure of the putative NEC1 protein resembles that of a transmembrane protein, indicating incorporation into either the cell membrane or cytoplast membrane .

The C-terminus of the protein is highly hydrophilic, while the N-terminal sequence shares significant homology with MtN3, a Rhizobium-induced gene involved in nodule development in Medicago trunculata . Specifically, the protein shows 47% identity and 72% similarity with MtN3, with highest homology observed in the N-terminal sequence, the first two and last two membrane-spanning loops .

Tissue-Specific Expression

NEC1 exhibits a highly tissue-specific expression pattern. Northern blot analyses and RT-PCR studies have demonstrated that NEC1 is predominantly expressed in nectary tissue of Petunia hybrida, with significantly weaker expression in stamens . Further RT-PCR analysis has revealed minimal expression in pistils, petals, and leaves .

In situ hybridization studies have provided more detailed insights into the spatial distribution of NEC1 mRNA within nectary tissue. High levels of NEC1 transcripts are primarily observed in the outer nectary parenchyma cells . This expression pattern corresponds well with the functional role of these cells in nectar production and secretion.

Developmental Regulation

The temporal expression profile of NEC1 has been characterized using RNA isolated from nectaries at different flower development stages. Interestingly, NEC1 mRNA accumulation begins in nectaries of closed flower buds that do not yet secrete nectar, with expression levels gradually increasing during nectary and flower development .

GUS reporter gene studies driven by the NEC1 promoter have confirmed this expression pattern and provided additional insights. GUS activity is detected as blue spots on the surface of very young nectaries that do not secrete nectar but accumulate starch. Maximum GUS expression occurs in open flowers where active nectar secretion and starch hydrolysis have occurred . This temporal pattern suggests that NEC1 expression coincides with and potentially regulates the processes of starch hydrolysis and nectar secretion.

Flower StageFlower ConditionAnther ConditionNectary ColorNectar SecretionNEC1 Expression
1 (3-4 cm)ClosedClosedWhiteNonePresent
2 (5-6 cm)ClosedClosedLight yellowMinimalIncreased
3 (6+ cm)OpenClosedYellowModerateHigh
4 (6+ cm)OpenOpenOrangeMaximumMaximum

Role in Nectary Development and Nectar Production

NEC1 plays crucial roles in proper nectary development and nectar production. Antisense suppression experiments have demonstrated that down-regulation of NEC1 results in impaired nectary development and severely reduced nectar production in Petunia hybrida . Furthermore, nectary-specific expression of the cytotoxic Barnase gene under control of the NEC1 promoter leads to cell ablation at early stages of nectary development, resulting in nectariless flowers .

Immunolocalization studies have shown that NEC1 protein is present in all nectary cells, with the highest concentration in the outer parenchyma cells . Subcellular localization reveals specific labeling around the plasmalemma and in small vesicles that appear to fuse with the plasmalemma, followed by nectar secretion . This pattern strongly suggests that NEC1 is directly involved in the process of nectar secretion, potentially by facilitating sugar transport across cellular membranes.

Role in Sugar Transport and Metabolism

As a member of the SWEET family of sugar transporters, NEC1 mediates both low-affinity uptake and efflux of sugar across the plasma membrane . It functions along concentration gradients, allowing bidirectional transport of sugars without relying on proton gradients . This property makes NEC1 ideally suited for roles in nectar secretion, where efficient sugar transport is essential.

Interestingly, ectopic expression of NEC1 in transgenic plants results in a distinctive phenotype characterized by leaves having 3-4 times more phloem bundles in mid-veins than wild-type Petunia . This observation suggests that NEC1 promotes the formation of phloem bundles in mid-veins, likely through its role in sugar transport and metabolism .

Impact on Anther Development and Pollen Viability

Beyond its roles in nectary function, NEC1 also influences anther development and pollen viability. NEC1 expression has been detected in the anther stomium and the upper part of the filament . Partial silencing of NEC1 through co-suppression and transposon mutagenesis results in an "early open anther" phenotype and disturbed in vitro pollen germination . These findings indicate that NEC1 is probably involved in the development of stomium cells that control anther opening time and is required for pollen viability .

Production Methods and Properties

Recombinant NEC1 protein can be produced in bacterial expression systems, typically using E. coli . The full-length protein (amino acids 1-265) is commonly fused to an N-terminal His-tag to facilitate purification . The recombinant protein is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

Evolutionary Context and Related Proteins

NEC1 is a homolog of AtSWEET9 and belongs to the SWEET (Sugars Will Eventually be Exported Transporter) family of sugar transporters . This family represents a relatively recently identified class of sugar transporters that function as bidirectional uniporters/facilitators, enabling sugar diffusion across cell membranes along concentration gradients .

The SWEET family is widely distributed in plants and plays central roles in various biochemical processes, including phloem loading of sugar for long-distance transport, pollen nutrition, nectar secretion, seed filling, fruit development, plant-pathogen interactions, and responses to abiotic stress .

Unlike other sugar transporters such as MSTs (Monosaccharide Transporters) and SUTs (Sucrose Transporters) that require coupling with H+ for transport, SWEET proteins transport sugar independently of pH and can move sugars in both directions across membranes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your requests.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NEC1; Bidirectional sugar transporter NEC1; NEC1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Petunia hybrida (Petunia)
Target Names
NEC1
Target Protein Sequence
MAQLRADDLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLL YYAYLRKNAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLMLLELGALGMVMPIT YLLAEGSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF FYGFFKKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIII NIEDDNSDNALQSMEKDFSRLRTSK
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane. It promotes the formation of phloem bundles in mid-veins. This protein is likely involved in the development of stomium cells, which control anther opening time. It is essential for pollen viability.
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in nectary tissue and weakly in the stamen, especially in stomium cells and in the upper part of the filaments.

Q&A

What is NEC1 and what is its role in Petunia hybrida?

NEC1 is a gene predominantly expressed in the nectaries of Petunia hybrida, initially identified through differential display RT-PCR technique. The NEC1 protein functions as a bidirectional sugar transporter that belongs to the SWEET (Sugars Will Eventually be Exported Transporter) family. Structurally, it is a transmembrane protein incorporated into the cell membrane or cytoplast membrane .

NEC1 plays multiple critical roles in plant development:

  • Primary function in nectar secretion by facilitating sucrose transport

  • Essential for pollen development and viability

  • Involved in anther dehiscence through development of stomium cells

  • Contributes to sugar metabolism during flower development

Immunolocalization studies have confirmed that the NEC1 protein is specifically present in nectary tissues, with highest expression in open flowers during active nectar secretion and starch hydrolysis .

How is NEC1 related to the SWEET family of sugar transporters?

NEC1 belongs to the SWEET family of sugar transporters and is specifically classified as 2.A.123.1.7 in the transporter classification database . The SWEET family represents a class of sugar transporters that function as bidirectional uniporters/facilitators that transport sugars across cell membranes along concentration gradients without requiring energy from proton gradients .

In some contexts, NEC1 is also referred to as SWEET9 and belongs to clade III of SWEET proteins, which are known to be sucrose transporters targeted to the plasma membrane . Like other plant SWEETs, NEC1 contains seven transmembrane domains (TMs) arranged in a characteristic "3-1-3" structure:

  • The fourth TM acts as a link

  • This divides the protein into two MtN3/saliva domains

  • Each domain contains three TMs forming a triple-helix bundle

This structural arrangement is essential for its function as a bidirectional sugar transporter.

What is the expression pattern of NEC1 in Petunia hybrida?

NEC1 exhibits a highly specific expression pattern in Petunia hybrida:

Tissue TypeExpression LevelDetection Method
Nectary tissueHighNorthern blot analysis
StamenWeakNorthern blot analysis
Outer nectary parenchyma cellsPresentGUS reporter assay
Upper part of filamentPresentGUS reporter assay
Anther stomiumPresentGUS reporter assay

Temporally, NEC1 expression follows a developmental pattern:

  • Initially appears as blue spots (via GUS assay) on very young nectaries that accumulate starch but do not yet secrete nectar

  • Expression reaches its peak in open flowers where active nectar secretion and starch hydrolysis occur

This expression pattern has also been observed in Brassica napus, suggesting evolutionary conservation of NEC1 function across different plant species .

How does NEC1 contribute to nectar secretion at the molecular level?

NEC1 (SWEET9) facilitates nectar secretion through a multi-step molecular process:

  • As a bidirectional sugar transporter, NEC1 enables the movement of sucrose from nectary parenchyma cells to the apoplast (extracellular space) along concentration gradients

  • This transport occurs without requiring energy in the form of a proton gradient, distinguishing it from other sugar transporter families

  • Once in the apoplast, the exported sucrose is hydrolyzed by cell wall invertases to produce glucose and fructose

  • These monosaccharides constitute the primary carbohydrates found in nectar

This mechanism has been demonstrated not only in Petunia hybrida but also in Arabidopsis thaliana, Brassica rapa, and Nicotiana attenuata, indicating it is a conserved process in nectar-producing plants . The developmental regulation of NEC1 expression correlates inversely with nectarial starch content, suggesting that NEC1 plays a role in the conversion of stored starch to secreted sugars during nectar production .

How does silencing or overexpression of NEC1 affect plant phenotype?

Genetic manipulation of NEC1 expression reveals its critical roles in plant development:

Silencing of NEC1:

  • Triggers male sterility in petunia

  • Results in early opening of anthers in Petunia hybrida

  • Reduces starch content in pollen (similar to findings with OsSWEET11 in rice)

  • Impairs nectar secretion, suggesting essential role in this process

Overexpression/Ectopic Expression of NEC1:

  • Produces transgenic plants with leaves having 3-4 times more phloem bundles in mid-veins than wild-type Petunia

  • Promotes the formation of phloem bundles in mid-veins, indicating involvement in vascular development

These phenotypic effects highlight NEC1's multifaceted roles in reproductive development, nectar production, and vascular architecture in plants, making it an important target for research on plant reproductive biology and nectar production.

What are the best methods for isolating and purifying recombinant NEC1?

Based on established protocols for recombinant NEC1 production, the following methodology is recommended:

Expression System and Conditions:

  • Host: E. coli is the preferred expression system for recombinant NEC1

  • Construct: Full-length Petunia hybrida NEC1 protein (amino acids 1-265) with an N-terminal His-tag

  • Expression conditions: Optimization of temperature, IPTG concentration, and induction time is recommended

Purification Protocol:

  • Cell lysis: Sonication or mechanical disruption in appropriate buffer

  • Primary purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Secondary purification: Size exclusion chromatography to remove aggregates

  • Quality assessment: SDS-PAGE analysis (target purity >90%)

  • Optional steps: Tag removal if required for downstream applications

Storage Recommendations:

  • Store as lyophilized powder for maximum stability

  • For solution storage, use Tris/PBS-based buffer with 50% glycerol at pH 8.0

  • Store at -20°C/-80°C for extended periods

  • Prepare working aliquots stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

How can the sugar transport activity of NEC1 be measured in vitro?

Several complementary approaches can be employed to measure NEC1 sugar transport activity:

1. FRET-Based Assays:

  • Principle: Uses fluorescence resonance energy transfer (FRET) sensors to monitor sugar concentration changes in real-time

  • Implementation: Co-express NEC1 with FRET glucose sensors (e.g., FLIPglu600μΔ13V) in mammalian cells

  • Measurement: Monitor FRET ratio changes upon sugar addition

  • Advantage: Allows real-time, non-destructive measurement of transport

2. Heterologous Expression Systems:

  • HEK293T cells: Express NEC1 along with cytosolic or ER-localized FRET sensors to measure both uptake and efflux

  • Yeast complementation: Express NEC1 in yeast strains lacking endogenous hexose transporters and measure growth on sugar media

  • Xenopus oocytes: Express NEC1 and perform two-electrode voltage clamp or radiotracer experiments

3. Radiotracer Experiments:

  • Principle: Use radiolabeled sugars (e.g., [14C]glucose) to quantitatively measure transport

  • Uptake assay: Incubate NEC1-expressing cells/oocytes with radiolabeled sugar and measure accumulation

  • Efflux assay: Preload cells with radiolabeled sugar and measure time-dependent release

  • Kinetic analysis: Determine transport parameters (Km, Vmax) by varying substrate concentration

4. Liposome Reconstitution:

  • Purify recombinant NEC1 and reconstitute into proteoliposomes

  • Measure sugar transport using radioisotope flux or fluorescent indicators

  • Advantage: Allows precise control of membrane composition and transport conditions

By combining these approaches, researchers can comprehensively characterize NEC1's transport properties, including substrate specificity, directionality, and kinetics.

What are the key considerations when designing experiments to study NEC1 function?

When designing experiments to study NEC1 function, researchers should consider these critical factors:

1. Expression Analysis Design:

  • Employ multiple techniques (Northern blot, qRT-PCR, RNA-seq) to quantify expression levels

  • Use promoter-reporter constructs (e.g., NEC1 promoter:GUS) to visualize spatial expression patterns

  • Consider temporal dynamics, particularly in relation to flower development and nectar production

2. Protein Localization Strategy:

  • Generate fluorescent protein fusions (both N- and C-terminal) to determine subcellular localization

  • Perform immunolocalization with specific antibodies as complementary approach

  • Consider co-localization studies with markers for different cellular compartments

3. Functional Characterization Parameters:

  • Select appropriate heterologous systems based on experimental goals:

    Expression SystemAdvantagesBest For
    HEK293T cellsMammalian glycosylation, FRET compatibilityTransport mechanism studies
    YeastNo endogenous glucose transportersSubstrate specificity analysis
    Xenopus oocytesLarge size, established for transportersElectrophysiology, radiotracer studies
  • Test multiple potential substrates at physiologically relevant concentrations

  • Include appropriate controls (non-functional mutants, empty vector)

4. Genetic Manipulation Approach:

  • Consider both silencing (RNAi, CRISPR knockout) and overexpression approaches

  • Use tissue-specific or inducible promoters to avoid developmental defects

  • Design careful phenotypic analyses focusing on nectaries, pollen development, and vascular architecture

5. Interactome Analysis:

  • Investigate potential oligomerization (SWEET proteins can form homo- and hetero-oligomers)

  • Study interactions with other components of nectar secretion pathway

  • Consider the role of NEC1 in wider sugar metabolism networks

6. Data Integration:

  • Correlate molecular data (expression, localization) with physiological outputs (nectar production, sugar composition)

  • Connect phenotypic observations to specific molecular mechanisms

  • Consider evolutionary context by comparing NEC1 function across species

By systematically addressing these considerations, researchers can develop robust experimental designs that yield meaningful insights into NEC1 function and its roles in plant biology.

How can CRISPR/Cas9 be used to study NEC1 function?

CRISPR/Cas9 technology offers powerful approaches for dissecting NEC1 function through precise genome editing:

1. Complete Gene Knockout:

  • Design sgRNAs targeting early exons of NEC1

  • Create frameshift mutations to abolish protein function

  • Analyze phenotypic consequences in nectaries, stamens, and vascular development

  • Quantify changes in nectar production, composition, and pollen viability

2. Domain-Specific Engineering:

  • Target specific domains of NEC1 (e.g., one of the two MtN3/saliva domains)

  • Generate in-frame deletions to investigate domain-specific functions

  • Create chimeric proteins by swapping domains with other SWEET family members

  • Determine the contribution of each domain to substrate specificity and transport mechanism

3. Structure-Function Analysis:

  • Design sgRNAs to introduce specific amino acid substitutions at conserved residues

  • Focus on residues predicted to be involved in substrate binding or conformational changes

  • Create an allelic series with varying degrees of functional impairment

  • Correlate molecular transport activity with physiological phenotypes

4. Regulatory Element Modification:

  • Target the NEC1 promoter to modify expression patterns

  • Engineer inducible or tissue-specific expression

  • Create reporter fusions at the endogenous locus via homology-directed repair

  • Study the consequences of altered expression on plant development

5. Molecular Tagging Strategy:

  • Use CRISPR-mediated homology-directed repair to introduce epitope or fluorescent tags

  • Create C-terminal fusions to visualize endogenous NEC1 localization and dynamics

  • Generate BioID or proximity labeling fusions to identify interacting proteins

  • Ensure tag insertion preserves protein function through complementation tests

This approach builds upon the successful application of TALEN-based genomic editing for engineering SWEET mutants in other contexts , offering greater precision and flexibility for NEC1 functional studies.

How can imaging techniques be used to study NEC1 localization and dynamics?

Advanced imaging approaches provide crucial insights into NEC1 localization, trafficking, and function:

1. Fixed Tissue Imaging:

  • Immunolocalization with NEC1-specific antibodies to detect endogenous protein

  • Process tissues using optimized fixation to preserve membrane structures

  • Counterstain with organelle markers to determine precise subcellular localization

  • Use super-resolution microscopy (STED, STORM) for nanoscale localization

2. Live-Cell Imaging Approaches:

  • Generate fluorescent protein fusions (YFP, GFP, mCherry) to visualize NEC1 in living cells

  • Create both N- and C-terminal fusions to ensure normal trafficking and function

  • Use spinning disk confocal microscopy for time-lapse imaging of protein dynamics

  • Employ FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility in membranes

3. Advanced Fluorescence Techniques:

  • FRET-FLIM (Förster Resonance Energy Transfer-Fluorescence Lifetime Imaging Microscopy) to detect protein-protein interactions

  • BiFC (Bimolecular Fluorescence Complementation) to visualize dimerization or protein complex formation

  • Optogenetic approaches to manipulate protein function with light

  • Single-molecule tracking to analyze transport dynamics

4. Correlative Microscopy:

  • Combine fluorescence imaging with electron microscopy (CLEM)

  • Use cryo-EM to visualize membrane protein organization

  • Implement array tomography for 3D reconstruction of nectary tissue architecture

  • Apply expansion microscopy for improved resolution of protein localization

5. Functional Imaging:

  • Couple fluorescent sugar analogs with NEC1 visualization

  • Use genetically encoded sugar sensors to monitor transport activity

  • Correlate protein localization with sites of sugar efflux

  • Perform calcium imaging to investigate potential regulatory mechanisms

These imaging approaches provide complementary data on NEC1 distribution, dynamics, and function across multiple scales, from molecular interactions to tissue-level organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.