Recombinant Petunia hybrida Chlorophyll a-b binding protein, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein, chloroplastic; LHCI type II CAB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-270
Protein Length
Full Length of Mature Protein
Species
Petunia hybrida (Petunia)
Target Protein Sequence
VSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLK WNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLI GWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTK EIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFSPK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is recombinant P. hybrida Chlorophyll a-b binding protein expressed and purified?

Expression Systems:
The recombinant PhCAB protein is typically expressed using the following systems:

Expression SystemAdvantagesCommon TagsNotes
E. coliHigh yield, cost-effectiveHis, GSTMost commonly used for PhCAB
YeastBetter for eukaryotic foldingHis, FLAGAlternative for difficult folding
BaculovirusPost-translational modificationsHis, StrepUsed for functional studies
Mammalian cellsNative-like modificationsHis, FcLeast commonly used for PhCAB

Purification Protocol:

  • Transform expression vector containing PhCAB sequence into E. coli

  • Culture cells and induce protein expression

  • Harvest cells by centrifugation

  • Lyse cells and collect the soluble fraction

  • Perform affinity chromatography (using His-tag)

  • Elute protein and perform buffer exchange

  • Assess purity by SDS-PAGE (>90% purity is standard)

  • Lyophilize or store in appropriate buffer with 50% glycerol

For optimal results, reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% glycerol as a stabilizer before aliquoting for long-term storage .

What experimental applications can utilize recombinant PhCAB?

Recombinant PhCAB is versatile in research applications:

  • Photosynthesis Research: Using purified PhCAB to reconstitute light-harvesting complexes in vitro to study energy transfer mechanisms .

  • Protein-Protein Interaction Studies: Employing tagged PhCAB as bait to identify interacting partners within photosynthetic machinery using pull-down assays or yeast two-hybrid screens .

  • Antibody Production: Generating specific antibodies against PhCAB for immunolocalization studies in plant tissues .

  • Functional Complementation: Introducing recombinant PhCAB into PhCAB-deficient plants to assess functional restoration of photosynthetic efficiency .

  • Structural Studies: Using purified PhCAB for crystallization attempts and subsequent X-ray diffraction analysis to determine high-resolution structures .

  • Educational Tools: Serving as a model protein for teaching protein purification and characterization techniques in laboratory courses.

  • Comparative Studies: Comparing properties of PhCAB with homologous proteins from other plant species to understand evolutionary conservation of photosynthetic components .

Each application requires specific considerations regarding protein purity, tag choice, and buffer composition to maintain native-like structure and function.

What are the optimal storage conditions for recombinant PhCAB?

Storage of recombinant PhCAB requires careful consideration to maintain stability and activity:

Storage FormTemperatureAdditivesDurationNotes
Lyophilized powder-20°C to -80°CNoneLong-termRecommended for extended storage
Solution (working aliquots)4°CTris/PBS-based buffer, pH 8.0Up to one weekAvoid repeated freeze-thaw cycles
Solution (long-term)-20°C to -80°C50% glycerolMonthsAliquoting necessary for multiple uses

For reconstitution, it is recommended to:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (preferably 50%)

  • Prepare small aliquots to avoid repeated freeze-thaw cycles

Repeated freezing and thawing significantly reduces protein stability and should be avoided. pH stability is also critical—maintaining pH at 8.0 in a Tris/PBS-based buffer with 6% trehalose provides optimal conditions for preserving protein structure and function .

How does silencing of PhCAB-related genes affect chloroplast development and photosynthesis in P. hybrida?

Gene silencing studies reveal significant insights into PhCAB function. When PhCAB expression is suppressed using virus-induced gene silencing (VIGS), several notable phenotypic and molecular changes occur:

Phenotypic Effects:

  • Sectored chlorotic leaf phenotype

  • Reduced chlorophyll levels

  • Abnormal chloroplast ultrastructure

  • Extended leaf longevity

  • Thicker leaves

Photosynthetic Parameters:

  • Decreased photosystem II activity

  • Reduced net photosynthesis

  • Altered chlorophyll fluorescence parameters (Fv/Fm)

Molecular Consequences:
A proteome analysis of PhCAB-silenced plants revealed significant changes in photosynthetic machinery:

  • 308 proteins upregulated

  • 266 proteins downregulated

  • 21 proteins of photosystem I and II significantly reduced

  • 12 thylakoid (thylakoid lumen and thylakoid membrane) proteins downregulated

These findings demonstrate that PhCAB is essential for proper chloroplast development and photosynthetic function. The silencing affects not only the direct components of the light-harvesting complexes but also leads to broader changes in chloroplast proteome composition, suggesting cascade effects on multiple aspects of photosynthesis and chloroplast biogenesis .

What methodologies can be used to study the interaction of PhCAB with other photosystem components?

Investigating PhCAB interactions with other photosystem components requires sophisticated methodological approaches:

In vitro Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies against PhCAB to pull down interacting proteins, followed by mass spectrometry identification.

  • Surface Plasmon Resonance (SPR): Measuring real-time binding kinetics between immobilized PhCAB and other purified photosystem components.

  • Isothermal Titration Calorimetry (ITC): Determining thermodynamic parameters of PhCAB interactions with partner proteins or pigments.

In vivo Methods:

  • Bimolecular Fluorescence Complementation (BiFC): Fusing split fluorescent protein fragments to PhCAB and potential interacting partners to visualize interactions in plant cells.

  • Förster Resonance Energy Transfer (FRET): Tagging PhCAB and interacting proteins with fluorophore pairs to detect proximity-dependent energy transfer.

  • Yeast Two-Hybrid (Y2H) Assays: Though challenging for membrane proteins, modified split-ubiquitin Y2H systems can be used for PhCAB interaction studies.

Structural Methods:

  • Cryo-Electron Microscopy: Examining the structure of PhCAB within larger photosystem complexes at near-atomic resolution.

  • Cross-linking Mass Spectrometry (XL-MS): Identifying interaction interfaces by chemically cross-linking adjacent proteins followed by MS identification.

Computational Methods:

  • Molecular Docking: Predicting interaction modes between PhCAB and other photosystem components based on available structural data.

  • Molecular Dynamics Simulations: Analyzing the stability and dynamics of PhCAB-containing complexes in a simulated membrane environment.

These methodologies can provide complementary information about the structural organization, binding affinities, and functional significance of PhCAB interactions within the photosynthetic machinery .

What regulatory mechanisms control PhCAB expression in P. hybrida?

The expression of PhCAB in Petunia hybrida is regulated through multiple mechanisms:

Transcriptional Regulation:

  • CONSTANS-like 16 (COL16): Studies show that PhCOL16 positively regulates chlorophyll biosynthesis and PhCAB expression. Overexpression of PhCOL16a in petunia results in higher chlorophyll content and increased expression of genes encoding key enzymes in the chlorophyll biosynthetic pathway .

  • Nuclear Factor Y (NF-Y) Transcription Factors: Specifically, PhNF-YC2 has been shown to influence chlorophyll content. Silencing PhNF-YC2 using VIGS results in reduced chlorophyll content, suggesting its role in regulating PhCAB expression .

  • Deoxyhypusine Synthase (DHS): PhDHS silencing leads to reduced chlorophyll levels and abnormal chloroplast development. Proteome analysis revealed that 21 proteins of photosystem I and II, including PhCAB, were downregulated in PhDHS-silenced plants .

Post-transcriptional Regulation:

  • Alternative Splicing: Evidence suggests that PhCAB transcripts undergo alternative splicing, generating protein isoforms with potentially different functions.

  • mRNA Stability: Various environmental factors influence PhCAB mRNA stability, affecting protein abundance.

Environmental Regulation:

  • Light Quality and Intensity: PhCAB expression is modulated by light conditions, with adaptation mechanisms to optimize photosynthesis.

  • Hormone Signaling: Plant hormones like gibberellins (GA) influence PhCAB expression. Proteins involved in GA biosynthesis showed altered levels in PhNF-YC2-silenced plants with reduced chlorophyll content .

  • Biostimulant Response: Application of animal-based protein hydrolysate (PH) biostimulant as foliar spray has been shown to increase chlorophyll index (SPAD), net photosynthesis, and stomatal conductance, potentially affecting PhCAB expression .

Understanding these regulatory mechanisms provides insights into how plants modulate their photosynthetic machinery in response to developmental and environmental cues.

How can recombinant PhCAB be used in structural studies and what are the associated challenges?

Structural Study Applications:

Methodological Challenges:

  • Protein Production Challenges:

    • Maintaining proper folding during expression

    • Ensuring stability during purification

    • Producing sufficient quantities for structural studies

    • Preserving native-like properties without the natural membrane environment

  • Crystallization Challenges:

    • Inherent flexibility of membrane proteins

    • Detergent selection for membrane protein solubilization

    • Finding optimal crystallization conditions

    • Growing crystals of sufficient size and quality for diffraction

  • Data Collection and Analysis Challenges:

    • Radiation damage during X-ray exposure

    • Phase determination for novel structures

    • Interpretation of electron density for bound pigments

    • Validating structural models against biochemical data

Innovative Approaches:

  • Lipidic Cubic Phase (LCP) Crystallization: A technique specifically developed for membrane proteins that provides a more native-like environment during crystal formation.

  • Fusion Protein Strategies: Incorporating stable protein domains to facilitate crystallization while minimizing interference with PhCAB structure.

  • Nanodiscs or Amphipols: Alternative membrane mimetics that can stabilize PhCAB in a near-native environment for structural studies.

  • Fragment-Based Approaches: Focusing on specific domains of PhCAB that may be more amenable to structural determination.

The structural information gained from these studies would significantly advance our understanding of light-harvesting mechanisms and provide templates for engineering improved photosynthetic systems .

How does PhCAB coordinate with chlorophyll biosynthesis in P. hybrida?

The coordination between PhCAB and chlorophyll biosynthesis represents a sophisticated regulatory network:

Molecular Coordination Mechanisms:

  • Co-regulation of Expression:

    • CONSTANS-like 16 (PhCOL16) positively regulates both chlorophyll biosynthesis genes and PhCAB expression

    • Overexpression of PhCOL16a in petunia results in higher chlorophyll content and increased expression of key chlorophyll biosynthesis enzymes

  • Feedback Regulation:

    • PhCAB protein levels influence chlorophyll biosynthesis through signaling pathways

    • Unbound PhCAB may serve as a sensor for free chlorophyll levels, triggering adjustments in biosynthetic rates

  • Coordinated Trafficking:

    • Synchronized import of newly synthesized PhCAB and chlorophyll into developing chloroplasts

    • Co-chaperone systems that facilitate proper assembly of PhCAB-chlorophyll complexes

Research Evidence:

Studies show that PhCOL16 homologs' expression patterns are associated with chlorophyll content, with lower levels in white corollas than in pale green corollas, and relatively high levels in leaves. This suggests that PhCOL16 homologs are involved in chlorophyll accumulation .

Introduction of a PhCOL16a overexpression construct into petunia resulted in:

  • Pale green corollas with higher chlorophyll content than wild-type plants

  • Significantly higher expression of genes encoding key enzymes of chlorophyll biosynthesis

  • Enhanced PhCAB levels to accommodate increased chlorophyll production

Experimental Approaches to Study This Coordination:

  • Transcriptome Analysis: Comparing expression profiles of PhCAB and chlorophyll biosynthesis genes under various conditions using RNA-seq.

  • Metabolic Labeling: Tracking newly synthesized chlorophyll molecules and their incorporation into PhCAB complexes using isotope labeling.

  • Protein-Metabolite Interaction Studies: Examining direct interactions between PhCAB and intermediates of the chlorophyll biosynthetic pathway.

  • Genetic Manipulation: Creating transgenic lines with altered expression of both PhCAB and chlorophyll biosynthesis genes to observe compensatory mechanisms.

This coordination ensures proper stoichiometry between PhCAB and chlorophyll, which is essential for efficient light harvesting and photoprotection .

What methodologies can be used to study post-translational modifications of PhCAB?

Post-translational modifications (PTMs) of PhCAB play crucial roles in regulating its function, localization, and interactions. Here are methodologies to study these modifications:

Mass Spectrometry-Based Approaches:

  • Bottom-up Proteomics:

    • Enzymatic digestion of PhCAB followed by LC-MS/MS analysis

    • Identification of modified peptides by mass shifts

    • Quantification of modification stoichiometry using label-free or labeled approaches

  • Top-down Proteomics:

    • Analysis of intact PhCAB to preserve modification patterns

    • Direct determination of combinatorial modifications

    • Characterization of proteoforms with different modification profiles

  • Targeted MS Methods:

    • Multiple Reaction Monitoring (MRM) for specific modified peptides

    • Parallel Reaction Monitoring (PRM) for improved selectivity

    • SWATH-MS for comprehensive PTM profiling

Enrichment Strategies:

  • Phosphorylation:

    • Immobilized Metal Affinity Chromatography (IMAC)

    • Titanium Dioxide (TiO₂) enrichment

    • Phospho-specific antibodies for immunoprecipitation

  • Glycosylation:

    • Lectin affinity chromatography

    • Hydrazide chemistry for glycopeptide capture

    • PNGase F treatment for N-glycan release and site identification

  • Ubiquitination and SUMOylation:

    • Affinity purification with tagged ubiquitin/SUMO

    • Antibodies against diglycine remnants

    • TUBE (Tandem Ubiquitin Binding Entities) for ubiquitinated protein enrichment

Functional Validation Methods:

  • Site-Directed Mutagenesis:

    • Replacing modified residues with non-modifiable variants

    • Phosphomimetic mutations (e.g., Ser to Asp/Glu)

    • Assessing functional consequences in vivo

  • In Vitro Enzymatic Assays:

    • Identifying kinases or phosphatases acting on PhCAB

    • Reconstituting modification reactions with purified enzymes

    • Measuring effects on PhCAB activity or interactions

  • Imaging Approaches:

    • Modification-specific antibodies for immunolocalization

    • FRET sensors for dynamic PTM monitoring

    • Super-resolution microscopy to visualize modified PhCAB localization

These methodologies provide complementary information about the types, sites, stoichiometry, and functional significance of PhCAB modifications, offering insights into how these modifications regulate photosynthetic efficiency and adaptation to environmental changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.