Recombinant Petunia hybrida Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Photosystem Q (B) Protein

Photosystem Q (B) protein, encoded by the psbA gene, represents one of the key components of Photosystem II (PSII) in plants, including Petunia hybrida. This protein is officially classified as EC 1.10.3.9 and is synonymously referred to as Photosystem II protein D1 or 32 kDa thylakoid membrane protein . The protein plays a central role in the electron transport chain of photosynthesis, functioning within the reaction center of PSII.

The D1 protein is initially synthesized as a precursor (pD1) with a short C-terminal extension that requires processing to form the mature, functional D1 protein. This maturation process is facilitated by carboxyl-terminal peptidase A (CtpA), which removes the C-terminal extension . This post-translational modification is critical for establishing the protein's ability to participate in water cleavage and oxygen evolution during photosynthesis.

Protein Sequence and Domains

The Photosystem Q (B) protein from Petunia hybrida consists of 344 amino acids in its mature form. Although the exact sequence of Petunia hybrida Photosystem Q (B) protein is not explicitly provided in the available sources, comparable proteins from related organisms provide insight into its likely structure. For instance, the homologous protein from Conocephalum conicum (liverwort) has a full amino acid sequence that includes multiple transmembrane domains and functional regions essential for electron transport .

The protein structure typically includes multiple membrane-spanning domains that anchor it within the thylakoid membrane of chloroplasts. These transmembrane regions are crucial for proper positioning of the protein within the PSII complex, enabling efficient electron transport during photosynthesis.

Role in Electron Transport

The Photosystem Q (B) protein serves as a critical component of the PSII reaction center, facilitating electron transfer during the light-dependent reactions of photosynthesis. As a central element of PSII, this protein contributes to the formation of an active electron transport chain that converts light energy into chemical energy.

Research findings indicate that defects in the processing or function of this protein can significantly impact photosynthetic efficiency. Studies have shown that proper C-terminal processing of the D1 protein is essential for the assembly and function of active PSII complexes .

Assembly into Photosystem Complexes

The Photosystem Q (B) protein plays a crucial role in the assembly of PSII complexes. In its mature form, the protein contributes to the formation of functional PSII monomers and dimers, which subsequently assemble into larger PSII supercomplexes. Research has demonstrated that the presence of unprocessed precursor D1 (pD1) instead of mature D1 can hinder the assembly of PSII supercomplexes .

In studies examining mutants with defective C-terminal processing, researchers observed that while PSII monomers and dimers could still form with unprocessed pD1, these complexes were nonfunctional. Additionally, these mutants exhibited a notable absence of PSII supercomplexes, indicating an unexpected connection between D1 protein maturation and supercomplex assembly in plants .

Expression Systems

Recombinant Petunia hybrida Photosystem Q (B) protein is typically produced using bacterial expression systems, primarily Escherichia coli. This approach allows for the efficient production of functional protein for research and commercial applications .

The recombinant protein may be expressed with various fusion tags, such as histidine (His) tags, to facilitate purification and subsequent analyses. These tagged versions of the protein retain the functional characteristics of the native protein while enabling simplified isolation procedures .

Photosynthesis Studies

Recombinant Petunia hybrida Photosystem Q (B) protein serves as a valuable tool in investigating photosynthetic processes. Researchers utilize this protein to examine the structural and functional aspects of PSII, particularly focusing on electron transport mechanisms and the assembly of photosynthetic complexes.

The availability of purified recombinant protein enables controlled experimental conditions for studying protein-protein interactions within the photosynthetic apparatus, as well as the effects of various environmental factors on protein stability and function.

Genetic Engineering and Mutagenesis

The psbA gene encoding the Photosystem Q (B) protein represents a target for genetic engineering approaches aimed at understanding photosynthetic processes. While not specific to Petunia hybrida, research has demonstrated the feasibility of site-directed mutagenesis of the psbA gene in other organisms, such as Chlamydomonas reinhardtii .

Recent advances in gene editing technologies, including CRISPR/Cas9 systems, have further expanded the potential for targeted modifications of genes encoding photosynthetic proteins in Petunia hybrida. For instance, research has demonstrated successful site-directed mutagenesis in Petunia × hybrida protoplast systems using direct delivery of purified Cas9 protein preassembled with guide RNA .

Processing and Maturation

Research has revealed that the C-terminal processing of the D1 protein precursor (pD1) is critical for PSII function. Studies have shown that the carboxyl-terminal peptidase A (CtpA) is essential for removing the C-terminal extension of pD1, with mutants lacking this enzyme unable to produce detectable levels of mature D1 protein .

Role in Chloroplast Development

Studies exploring the relationship between photosynthetic proteins and chloroplast development in Petunia have provided valuable insights into the broader functional significance of these proteins. Research involving silencing of the deoxyhypusine synthase (DHS) gene in Petunia demonstrated reduced levels of proteins involved in both Photosystem I (PSI) and Photosystem II (PSII), including the D1 protein .

This research revealed that DHS-silenced plants exhibited yellow leaves, reduced chlorophyll levels, and abnormal chloroplast ultrastructure, suggesting a crucial role for photosynthetic proteins in normal chloroplast development. Proteome analysis of these plants confirmed significant reductions in PSI and PSII proteins, highlighting the interconnected nature of various cellular components in maintaining functional photosynthetic machinery .

Table 2: Impact of DHS Silencing on Photosystem Proteins in Petunia

ProteinChange in DHS-Silenced PlantsFunctional Impact
Photosystem II D2 protein (PsbD)ReducedImpaired PSII function
PsbQ1ReducedCompromised oxygen evolution
Photosystem Q (B) protein (D1)ReducedDefective electron transport

Comparison with Homologous Proteins

Comparisons between the Photosystem Q (B) protein from Petunia hybrida and homologous proteins from other organisms reveal evolutionary conservation of this essential photosynthetic component. The protein shares significant structural and functional similarities with counterparts from various plant species, including algae and liverworts.

Table 3: Comparison of Photosystem Q (B) Protein Across Selected Species

SpeciesProtein LengthNotable FeaturesSequence Similarity to P. hybrida
Petunia hybrida344 aaEssential for PSII function100% (reference)
Conocephalum conicum344 aaSimilar domain organizationHigh (exact % not specified)
Chlamydomonas reinhardtiiSimilarTarget for site-directed mutagenesis studiesModerate conservation

The high degree of conservation across diverse photosynthetic organisms underscores the fundamental importance of this protein in the photosynthetic process throughout evolutionary history.

Structure-Function Relationships

Analysis of the structure-function relationships within the Photosystem Q (B) protein has provided insights into the mechanisms underlying its role in photosynthesis. Research has demonstrated that specific domains within the protein are crucial for its integration into the thylakoid membrane and its interactions with other components of the PSII complex.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Petunia hybrida (Petunia)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSSENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.