Recombinant Petunia sp. Chlorophyll a-b binding protein 13, chloroplastic (CAB13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
CAB13; Chlorophyll a-b binding protein 13, chloroplastic; LHCII type I CAB-13; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-266
Protein Length
Full Length of Mature Protein
Species
Petunia sp. (Petunia)
Target Names
CAB13
Target Protein Sequence
RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPATFAK NRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFKEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELEVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the relationship between CAB13 and other chlorophyll binding proteins in the Petunia genus?

CAB13 belongs to the family of chlorophyll a-b binding proteins that function within the light-harvesting complexes of photosynthetic organisms. Based on comparative studies with CAB25 (another member of this protein family), these proteins share structural similarities including conserved domains for pigment binding and membrane integration . The functional relationship between different CAB proteins can be investigated through phylogenetic analysis and expression pattern comparisons. Methodologically, researchers should employ sequence alignment tools to identify conserved regions and differential expression analysis to understand tissue-specific functions.

What expression systems are most effective for producing recombinant CAB13?

For successful expression of functional CAB13, E. coli-based systems have demonstrated efficacy similar to what has been observed with CAB25 . The methodology requires optimization of:

ParameterRecommendationRationale
Expression vectorpET series with His-tagFacilitates purification via affinity chromatography
E. coli strainBL21(DE3)Reduces proteolytic degradation
Induction temperature16-18°CPromotes proper folding of membrane proteins
IPTG concentration0.1-0.5 mMBalances expression yield with protein solubility

Researchers should note that membrane proteins like CAB13 often require specialized approaches to maintain native conformation. Expression testing should include initial small-scale optimization experiments before scaling up to production levels .

How should researchers optimally store and handle recombinant CAB13 preparations?

Storage conditions significantly impact the stability and functionality of recombinant CAB13. Based on protocols established for similar proteins:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Implement aliquoting for multiple uses to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • For short-term use, store working aliquots at 4°C for up to one week

The storage buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) has been shown to maintain stability of similar chlorophyll binding proteins and likely applies to CAB13 as well .

How do genetic modifications of CAB13 impact photosynthetic efficiency and plant development in Petunia?

Investigating the functional impact of CAB13 modifications requires sophisticated genetic approaches. CRISPR/Cas9-based gene editing, as demonstrated with other petunia proteins, offers precise manipulation capabilities . Researchers should:

  • Design sgRNAs targeting conserved regions of CAB13

  • Develop a viral-based CRISPR/Cas9 delivery system similar to what has been used for EVER gene studies

  • Characterize knockout phenotypes through:

    • Chlorophyll fluorescence measurements (Fv/Fm ratios)

    • Photosynthetic rate determinations

    • Growth and developmental analyses

    • Transcriptomic profiling to identify compensatory mechanisms

Gene editing efficiency can be enhanced through optimization of vector design and transformation protocols specific to petunia tissues .

What role might CAB13 play in the regulation of volatile emission in Petunia flowers?

Recent studies on petunia EVER transcription factor have revealed unexpected links between photosynthetic machinery and volatile emission . A methodological approach to investigate CAB13's potential role would include:

  • Temporal expression analysis of CAB13 throughout flower development, particularly correlating with volatile emission phases

  • Creation of CAB13 knockout or overexpression lines using VIGS or CRISPR techniques

  • Dynamic headspace and GC-MS analyses of volatiles from modified plants compared to wild-type

  • Assessment of whether CAB13 expression correlates with epicuticular wax composition, which has been implicated in volatile emission

The diurnal expression pattern analysis should be conducted similar to what was done for EVER, with sampling throughout the day to capture rhythmic expression patterns that might correlate with volatile production cycles .

How can researchers resolve contradictory experimental data when studying CAB13?

When analyzing complex experimental data related to CAB13 function, researchers may encounter contradictions that complicate interpretation. A systematic approach to resolving these contradictions includes:

  • Implement a structured notation system for contradiction patterns (α, β, θ), where:

    • α represents the number of interdependent experimental variables

    • β represents the number of contradictory dependencies identified

    • θ represents the minimal number of Boolean rules needed to assess these contradictions

  • Apply Boolean minimization techniques to reduce complex contradiction patterns to manageable rule sets

  • Distinguish between biological variations and methodological inconsistencies

  • For CAB13 specifically, examine how contradictions might arise from:

    • Developmental stage differences

    • Environmental condition variations

    • Genetic background effects

    • Post-translational modification states

This methodological framework supports rigorous data quality assessment in complex biological systems .

What spectroscopic methods are most informative for analyzing CAB13-pigment interactions?

For detailed characterization of CAB13-pigment binding properties, researchers should employ a multi-method spectroscopic approach:

MethodInformation ObtainedTechnical Considerations
Circular DichroismProtein secondary structure and pigment binding-induced conformational changesRequires 0.1-1 mg/mL purified protein in low-salt buffer
Fluorescence SpectroscopyEnergy transfer between chlorophylls and proteinAvoid self-quenching by using dilute samples (1-10 μg/mL)
Absorption SpectroscopyPigment binding stoichiometry and affinityAnalyze spectral shifts upon titration with chlorophylls
Resonance RamanSpecific chlorophyll-protein interactionsRequires specialized instrumentation

Data analysis should incorporate global fitting of multiple spectroscopic datasets to develop comprehensive binding models.

How does the developmental regulation of CAB13 compare with EVER transcription factor during flower development?

Based on studies of developmental regulation in petunia flowers, researchers investigating CAB13 should:

  • Conduct qPCR analysis of CAB13 expression across developmental stages (from 2cm buds through 2 days post-anthesis)

  • Compare expression patterns with those of regulatory factors like EVER

  • Analyze potential hormonal regulation by:

    • Testing effects of gibberellic acid (GA) application on CAB13 expression

    • Evaluating jasmonic acid (JA) influence, which has shown significant effects on volatile emission

  • Investigate tissue-specific expression between adaxial epidermis vs. whole petal tissue

This comparative approach would reveal potential co-regulation or antagonistic regulation between photosynthetic proteins and transcription factors during flower development .

What purification strategy yields the highest purity and functional retention for recombinant CAB13?

A multi-step purification protocol optimized for membrane-associated chlorophyll binding proteins includes:

  • Initial immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

  • Secondary ion exchange chromatography to remove E. coli contaminants

  • Size exclusion chromatography to separate oligomeric states

  • Quality assessment via SDS-PAGE (target purity >90%)

  • Functional verification through chlorophyll binding assays

Throughout purification, maintain detergent concentrations above critical micelle concentration to prevent protein aggregation. Monitor protein quality at each step using both analytical SDS-PAGE and functional assays to ensure retention of native properties .

How can researchers effectively measure the chlorophyll binding capacity of recombinant CAB13?

To quantify chlorophyll binding properties:

  • Prepare chlorophyll extracts from petunia leaves using 80% acetone extraction

  • Determine chlorophyll a:b ratios and concentrations spectrophotometrically

  • Perform binding assays by titrating purified CAB13 with increasing chlorophyll concentrations

  • Monitor binding through:

    • Fluorescence emission changes (quenching upon binding)

    • Absorption spectral shifts

    • Changes in circular dichroism spectra

Data analysis should employ Scatchard plot or non-linear regression methods to determine binding constants and stoichiometry. Critical controls include heat-denatured protein and non-related proteins of similar size.

What transcriptomic approaches are most suitable for studying CAB13 regulation networks in Petunia?

Based on successful transcriptomic studies in petunia , researchers should:

  • Implement cell-layer-specific transcriptomic analysis, particularly focusing on:

    • Adaxial epidermis vs. whole petal comparisons

    • Developmental time course sampling

    • Diurnal expression pattern analysis

  • Design RNA-Seq experiments with:

    • Minimum 3 biological replicates

    • Sequencing depth >20 million reads per sample

    • Paired-end sequencing for improved transcript assembly

  • Validate key findings through:

    • qPCR of selected genes

    • In situ hybridization to confirm tissue-specific expression

    • Promoter-reporter constructs to visualize expression patterns

This layered approach provides comprehensive insights into the regulatory networks controlling CAB13 expression in different tissues and developmental contexts .

How can researchers determine the membrane topology and chloroplast insertion mechanism of CAB13?

Determining the precise membrane topology requires a combination of computational prediction and experimental verification:

  • Begin with in silico topology predictions using algorithms specific for chloroplast proteins

  • Verify predictions experimentally through:

    • Protease protection assays with isolated chloroplasts

    • Site-directed fluorescence labeling of specific residues

    • Cysteine scanning mutagenesis combined with membrane-impermeable thiol reagents

  • For insertion mechanism studies:

    • Develop in vitro chloroplast import assays using isolated chloroplasts and radiolabeled CAB13

    • Create truncation constructs to identify essential targeting sequences

    • Use crosslinking approaches to capture transient interactions with translocon components

This multi-faceted approach provides structural insights essential for understanding CAB13 function within the thylakoid membrane.

What are the most effective approaches for studying post-translational modifications of CAB13?

To comprehensively characterize post-translational modifications of CAB13:

  • Employ mass spectrometry-based proteomics workflows:

    • Bottom-up proteomics with tryptic digestion for sequence coverage

    • Top-down proteomics to maintain intact protein and modification relationships

    • Targeted MS/MS for known or suspected modification sites

  • Investigate specific modifications including:

    • Phosphorylation (critical for regulatory functions)

    • Acetylation (potentially involved in protein stability)

    • N-terminal processing (common in chloroplast-imported proteins)

  • Develop site-specific antibodies against modified forms for:

    • Western blot analysis under different conditions

    • Immunolocalization studies

    • Immunoprecipitation to identify interacting partners specific to modification states

This comprehensive characterization of post-translational modifications will reveal regulatory mechanisms controlling CAB13 function and turnover.

What emerging technologies might advance our understanding of CAB13 function in the future?

The future of CAB13 research will benefit from cutting-edge approaches including:

  • Cryo-electron microscopy for high-resolution structural determination in near-native states

  • Single-molecule tracking in vivo to observe dynamic behaviors within the chloroplast

  • Optogenetic tools to manipulate CAB13 function with spatiotemporal precision

  • Systems biology approaches integrating multi-omics data to position CAB13 within broader regulatory networks

  • Advanced CRISPR-based technologies for precise genomic manipulation with minimal off-target effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.