Recombinant Petunia sp. Chlorophyll a-b binding protein 22L, chloroplastic (CAB22L)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CAB22L belongs to the light-harvesting complex II (LHCII) family, which captures and transfers light energy in chloroplasts. The recombinant form includes a His-tag for purification and retains the functional domain of the native protein from Petunia species .

PropertyDetails
Host OrganismEscherichia coli
Source SpeciesPetunia sp.
TagN-terminal His-tag
Mature Protein Length232 amino acids (residues 36–267)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -80°C
UniProt IDP04780

Genetic Regulation

The Cab22L gene is regulated by cis-acting elements in its promoter region. Mutational studies identified critical sequences for transcriptional activity :

Cis-ElementLocationImpact on Expression
GATA box repeats-145 to -925-fold reduction in transcript levels if mutated
CAAT boxNear TATA8-fold reduction in transcript levels if mutated
13 bp conserved region-145 to -9220-fold reduction if deleted

Divergent promoter regions with Cab22R allow compensatory regulation, ensuring robust expression under varying conditions .

Photosynthesis Studies

  • Used to dissect energy transfer mechanisms in LHCII complexes .

  • Serves as a template for engineering light-harvesting efficiency in crops .

Biotechnology

  • Promoter engineering: The Cab22L promoter drives transgene expression in synthetic constructs, such as insect-resistant cotton (e.g., TwinLink™ cotton) .

  • Chloroplast transformation: CAB22L-derived sequences aid in developing species-specific vectors for algal chloroplast engineering .

Case Study: Synthetic Biology

The Cab22L 5'UTR and promoter were integrated into chloroplast expression vectors for Chlorella vulgaris, enabling heterologous protein production (e.g., human bFGF) . This approach achieved recombinant protein yields of 0.26–1.42 ng/g fresh biomass .

Future Directions

Ongoing research focuses on:

  • Optimizing CAB22L-based vectors for high-yield biopharmaceutical production in microalgae .

  • Engineering CAB22L variants with enhanced thermostability for agricultural applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CAB22L; Chlorophyll a-b binding protein 22L, chloroplastic; LHCII type I CAB-22L; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Petunia sp. (Petunia)
Target Names
CAB22L
Target Protein Sequence
RKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYPGGSFDPLGLAEDPEAFAELKVKE TKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPVNNNAWSYATNFVPRK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor. It captures and delivers excitation energy to photosystems with which it is closely associated.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Petunia sp. Chlorophyll a-b binding protein 22R?

The Petunia sp. Chlorophyll a-b binding protein 22R (CAB22R) is a chloroplastic protein with a full mature length spanning amino acids 36-267. The protein contains a typical CAB domain composed of the 91-254 amino acid segment (164 amino acids in length) . The secondary structure consists of approximately 33.10% α-helix, 37.59% random coil, and 19.66% extended strand . The protein contains binding sites for 4 chlorophyll-a molecules, 3 chlorophyll-b molecules, and one 1,2-dipalmitoyl-phosphatidyl-glycerole . Additionally, CAB22R contains an SH3 (Src Homology-3) domain (residues 146-207) and two internal repeats in regions 105-140 and 216-251 with 44% identity between these repeats .

How is recombinant CAB22R protein typically produced for research applications?

Recombinant CAB22R protein can be efficiently produced using E. coli expression systems. The typical methodology involves:

  • Cloning the mature protein sequence (amino acids 36-267) into an expression vector

  • Adding an N-terminal His tag for purification purposes

  • Expressing the protein in E. coli under optimal induction conditions

  • Purifying using affinity chromatography to achieve >90% purity as determined by SDS-PAGE

The final product is typically provided as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For research applications, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage stability .

What experimental designs are most appropriate for studying CAB protein function in different plant species?

When studying CAB protein function across plant species, researchers should consider implementing true experimental designs with appropriate controls. Based on standard experimental design principles, the following approaches are recommended:

Table 1: Experimental Design Options for CAB Protein Studies

Design TypeDescriptionAdvantagesLimitationsValidity Control
Pretest-Posttest Control Group DesignR O X O
R O O
Controls for history, maturation, testing effectsRequires randomizationStrong internal validity
Solomon Four-Group DesignR O X O
R O O
R X O
R O
Controls for all factors plus interaction of testingResource intensiveExcellent internal and external validity
Posttest-Only Control Group DesignR X O
R O
Simplicity, avoids testing effectsNo baseline measurementGood validity when randomization is possible

Here, R = randomization, O = observation/measurement, X = experimental treatment .

The Solomon Four-Group Design offers the most comprehensive approach for studying CAB proteins as it controls for testing effects while providing multiple comparison groups, which is especially valuable when examining stress responses that might be affected by initial measurements .

How should researchers design experiments to study differential expression of CAB genes under various stress conditions?

Based on studies of CAB genes in tea plants, a systematic approach to studying differential expression under stress conditions should include:

  • Gene identification and cloning: First identify and clone the CAB genes of interest from your plant species .

  • Stress treatment design: Apply multiple stress conditions in parallel experiments with appropriate controls. Based on prior research, consider including:

    • Cold stress

    • Drought stress

    • High light intensity

    • Hormonal treatments (e.g., ABA)

    • Salt stress

    • Nutrient deficiency

  • Time-course analysis: Measure gene expression at multiple time points (e.g., 0h, 1h, 3h, 6h, 12h, 24h, 48h) to capture both immediate and delayed responses.

  • Expression analysis: Use qRT-PCR with appropriate reference genes for normalization.

  • Data presentation: Organize data in tables showing fold changes compared to control conditions:

Table 2: Example Format for CAB Gene Expression Analysis Under Multiple Stresses

Gene IDCold StressDrought StressABA Treatment
6h24h48h6h24h48h6h24h48h
CAB1+1.2-2.3-3.5-1.5-2.8-4.2+0.5-1.8-3.1
CAB2+2.8+1.5+0.8-0.4-1.2-1.8+2.1+1.4+0.6

Values represent log2 fold changes compared to control conditions.

As seen in studies with tea plant CAB genes, expression patterns may vary significantly between genes even within the same family, with some being downregulated under stress (like CsCP1) and others showing upregulation (like certain subfamily members) .

What methodologies are most effective for determining chlorophyll binding properties of recombinant CAB proteins?

To effectively characterize chlorophyll binding properties of recombinant CAB proteins like CAB22R, researchers should employ a multi-method approach:

  • Spectroscopic Analysis:

    • Absorption spectroscopy (350-700 nm range) to detect characteristic chlorophyll binding peaks

    • Circular dichroism (CD) spectroscopy to analyze secondary structure alterations upon pigment binding

    • Fluorescence resonance energy transfer (FRET) to determine energy transfer efficiency

  • Binding Affinity Determination:

    • Isothermal titration calorimetry (ITC) to measure binding constants

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Microscale thermophoresis for interaction analysis in solution

  • Structural Confirmation:

    • Use SWISS-MODEL and Phyre2 analysis to model the protein structure based on homology with known structures

    • Validate models by comparing with cryoEM structures of similar proteins (e.g., spinach PSII-LHCII)

The methodological workflow should include protein preparation in detergent micelles or nanodiscs to maintain native-like membrane environments during analysis.

How can researchers distinguish between the functions of different CAB protein family members in photosystem II?

Distinguishing the specific functions of different CAB family members requires a systematic approach combining molecular, biochemical, and physiological techniques:

  • Comparative Sequence Analysis:

    • Analyze domains and motifs that differentiate family members (e.g., CsCP1 vs. CsCP2)

    • Identify key differences in chlorophyll binding residues

    • Map internal repeats and conserved regions

  • Subcellular Localization Studies:

    • Use GFP fusion proteins to determine precise locations within chloroplast structures

    • Employ immunogold electron microscopy for high-resolution localization

    • Perform fractionation studies to determine association with specific photosystem components

  • Functional Complementation:

    • Express individual CAB proteins in mutant lines lacking specific family members

    • Measure recovery of photosynthetic function through chlorophyll fluorescence

    • Assess energy transfer efficiency using time-resolved spectroscopy

  • Expression Pattern Analysis:

    • Compare expression under different conditions to identify specialized roles

    • Create expression profile tables showing differential responses to stresses (as shown in tea plant studies where expression patterns varied significantly)

Table 3: Distinguishing Features of CAB Protein Family Members Based on Tea Plant Studies

FeatureExternal Antenna Proteins (LHCb2-like)Internal Antenna Proteins (LHCb5-like)
Protein HomologyHomologous to LHCb2 (K08913)Homologous to LHCb5 (K08916)
Response to StressVariable (gene-dependent)Typically downregulated
Protein Size~265 aa (28.65 kDa)~254 aa (variable)
Structural Features38.11% α-helix, 33.21% random coil33.10% α-helix, 37.59% random coil
pI~5.97~6.33

This classification is based on the findings from tea plant CAB proteins, which showed distinct structural and functional characteristics between external and internal antenna proteins .

How can gene expression profiling of CAB genes be used to understand plant stress responses?

Gene expression profiling of CAB genes provides valuable insights into plant stress responses through multi-dimensional analysis:

  • Stress-Specific Expression Patterns:
    Based on studies in tea plants, CAB genes show characteristic expression patterns under different stresses:

    • Some CAB genes (like CsCP1) are consistently downregulated under multiple stresses

    • Others (like CsCP2) show stress-specific responses, with upregulation only under specific conditions like cold stress and ABA treatment

    • Certain family members (like CSA016997 and CSA030476) exhibit significant upregulation under all stress conditions

  • Temporal Expression Analysis:
    Creating temporal expression profiles allows researchers to:

    • Identify immediate early response genes

    • Distinguish between primary and secondary stress responses

    • Determine if expression changes are transient or sustained

  • Methodological Approach:

    • Use qRT-PCR for targeted gene analysis

    • Employ RNA-Seq for genome-wide expression patterns

    • Validate findings with protein-level analysis (Western blotting)

    • Present data using temporally ordered tables showing expression dynamics

  • Interpretation Framework:

    • Correlate CAB gene expression with physiological parameters (e.g., photosynthetic efficiency)

    • Compare expression patterns across multiple stresses to identify common response pathways

    • Develop predictive models for plant adaptation to changing environmental conditions

This multi-layered approach enables researchers to use CAB gene expression as molecular markers for specific stress responses and potential targets for enhancing plant stress tolerance.

What strategies are recommended for investigating protein-protein interactions between CAB proteins and other photosystem components?

Investigating protein-protein interactions between CAB proteins and other photosystem components requires sophisticated methodological approaches:

  • In Vitro Interaction Analysis:

    • Co-immunoprecipitation (Co-IP) using anti-His tag antibodies for recombinant CAB22R protein

    • Pull-down assays with purified components

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • In Vivo Interaction Studies:

    • Split-GFP complementation assays

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Proximity-dependent biotin identification (BioID)

  • Structural Approaches:

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

    • Single-particle cryo-electron microscopy for complex structural analysis

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map binding regions

  • Data Integration and Visualization:

    • Create concept-evidence tables correlating interaction evidence from multiple methods

    • Develop co-occurrence tables to visualize interaction networks

    • Use cross-case analysis tables to compare interaction profiles across different experimental conditions

When designing these experiments, carefully consider the physiological relevance of detergent selection for membrane protein solubilization, as this can significantly impact protein-protein interaction preservation.

What are the optimal storage conditions for maintaining the stability and activity of recombinant CAB proteins?

Based on established protocols for recombinant CAB22R protein, the following storage and handling recommendations should be followed to maintain optimal stability and activity:

  • Long-term Storage:

    • Store lyophilized protein powder at -20°C to -80°C

    • After reconstitution, store in aliquots with 5-50% glycerol (optimal: 50%) at -20°C to -80°C

    • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • Short-term Storage:

    • For experiments spanning 1-7 days, store working aliquots at 4°C

    • Protect from light exposure to prevent photooxidation of bound chlorophylls or the protein itself

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening to collect all material at the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For functional studies, use a Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Handling Precautions:

    • Minimize exposure to strong light

    • Maintain constant temperature during experiments

    • Use non-metallic spatulas and plastic containers when possible to prevent metal-induced oxidation

Adherence to these storage guidelines is essential for maintaining protein integrity and ensuring reproducible experimental results, as chlorophyll-binding proteins are particularly sensitive to storage conditions.

How should researchers monitor the stability and integrity of stored CAB proteins over time?

Monitoring the stability and integrity of stored CAB proteins requires multiple analytical approaches:

  • Spectroscopic Analysis:

    • UV-Visible spectroscopy to monitor the characteristic absorption peaks of protein-bound chlorophylls

    • Circular dichroism (CD) to assess secondary structure preservation

    • Fluorescence spectroscopy to evaluate chlorophyll-protein interactions

  • Functional Assays:

    • Chlorophyll binding efficiency tests

    • Energy transfer measurements if applicable to the specific CAB protein

  • Biochemical Analysis:

    • SDS-PAGE to check for degradation products

    • Size exclusion chromatography to monitor aggregation

    • Native PAGE to assess oligomeric state preservation

  • Stability Validation Protocol:

    • Establish a baseline immediately after reconstitution

    • Test samples at defined intervals (1 week, 1 month, 3 months)

    • Document changes in stability parameters using a temporal data table

Table 4: Example Stability Monitoring Schedule for Recombinant CAB Proteins

Storage TimeSDS-PAGEAbsorption SpectraCD SpectrumFunctional Activity
Day 0 (Baseline)100%
1 Week at 4°COptional
1 Month at -20°C
3 Months at -20°C
After Freeze-ThawOptional

Regular monitoring using this approach allows researchers to establish reliable storage durations and correctly interpret experimental results by accounting for any protein degradation or activity loss.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.