Recombinant Petunia sp. Chlorophyll a-b binding protein 22R, chloroplastic (CAB22R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB22R; Chlorophyll a-b binding protein 22R, chloroplastic; LHCII type I CAB-22R; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Petunia sp. (Petunia)
Target Names
CAB22R
Target Protein Sequence
RKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPSDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVWFKAGAQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is CAB22R and what role does it play in photosynthesis?

CAB22R is a chlorophyll a-b binding protein localized in the chloroplasts of Petunia species. It functions as a component of the light-harvesting complex II (LHCII), playing a critical role in capturing light energy during photosynthesis. The protein, also known as LHCII type I CAB-22R or LHCP, is encoded by one of at least 16 genes in the Petunia genome that produce chlorophyll a/b binding proteins .

CAB22R specifically binds chlorophyll molecules and carotenoids, facilitating the absorption of light energy and its transfer to photosynthetic reaction centers. This protein contributes to photosynthetic efficiency by expanding the light absorption spectrum of photosystem II, allowing plants to utilize a broader range of light wavelengths for photosynthesis.

The expression of CAB22R is light-regulated, making it an excellent model for studying light-mediated gene expression in plants. Multiple cis-acting elements in its promoter region play crucial roles in regulating transcript levels in response to light stimuli .

How is the CAB22R gene organized within the Petunia genome?

The CAB22R gene belongs to a multigene family in Petunia, with at least 16 genes encoding chlorophyll a/b binding proteins . These genes have been classified into small multigene families based on nucleotide sequence homology. CAB22R specifically belongs to the LHCII type I category.

The gene structure of CAB22R is characterized by an uninterrupted open reading frame encoding 266-267 amino acids . Unlike many plant genes, CAB22R does not contain introns, which is a common feature of the CAB gene family in Petunia. This absence of introns may facilitate rapid gene expression in response to light stimuli.

Within the Petunia genome, CAB22R is physically positioned adjacent to another CAB gene, CAB22L, with which it shares a divergent orientation . This arrangement creates an intergenic promoter region of approximately 1 kb that regulates both genes. This divergent arrangement may allow coordinated expression or shared regulatory elements.

What are the key regulatory elements in the CAB22R promoter region?

The promoter region of CAB22R contains several key regulatory elements that control its expression, particularly in response to light. Systematic mutational studies of the 1 kb intergenic promoter region between CAB22R and CAB22L have identified specific cis-acting elements critical for gene expression .

Key regulatory elements include:

  • TATA box: A common eukaryotic promoter element essential for determining the transcription start site.

  • CAAT box: Site-specific mutations in this element resulted in an 8-fold reduction in CAB22R transcript levels, indicating its crucial role in maintaining expression levels .

  • GATA box sequence repeats: Three GATA box sequence repeats are positioned between the TATA and CAAT box elements. These elements are conserved in corresponding promoter regions of all LHCII Type I Cab genes in Petunia and other dicotyledonous plants. Mutations in these elements led to a 5-fold reduction in transcript levels .

  • Region between -92 and -145: A deletion of 52 bp adjacent and upstream from the CAAT box in this region reduced transcript levels 20-fold. This region contains a 13 bp sequence that is conserved among many Petunia Cab genes .

Regulatory ElementPositionEffect of Mutation/DeletionConservation
TATA boxProximal promoterNot specified in resultsCommon in eukaryotic promoters
CAAT boxProximal promoter8-fold reduction in transcript levelsCommon in eukaryotic promoters
GATA box repeatsBetween TATA and CAAT boxes5-fold reduction in transcript levelsConserved in LHCII Type I Cab genes
-92 to -145 regionUpstream of CAAT box20-fold reduction in transcript levelsContains 13 bp conserved sequence

Interestingly, deletion of the region between -92 and -145 in the CAB22R promoter is partially compensated by homologous sequences present in the adjacent divergent promoter CAB22L , suggesting a complex interplay between these divergent promoters.

What are the recommended protocols for isolating and purifying recombinant CAB22R?

Isolating and purifying recombinant CAB22R requires careful consideration of its properties as a membrane-associated chloroplastic protein. The following methodology is recommended:

Expression System Selection:
For recombinant expression of CAB22R, E. coli expression systems are commonly used, though eukaryotic systems like yeast or insect cells may provide better folding for this plant protein. When expressing in bacteria, consider using strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)).

Expression Construct Design:

  • Clone the coding sequence corresponding to the mature protein (amino acids 36-267) without the transit peptide .

  • Consider adding a purification tag (His-tag, GST, etc.) preferably at the C-terminus to avoid interference with chloroplast targeting sequences.

  • Use a vector with an inducible promoter (e.g., T7) to control expression levels.

Protein Expression Protocol:

  • Transform the expression construct into the selected host strain.

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8.

  • Induce protein expression with an appropriate inducer (e.g., IPTG for T7 promoters).

  • Lower the temperature to 18-20°C during induction to facilitate proper folding.

  • Continue expression for 16-20 hours.

Extraction and Purification:

  • Harvest cells by centrifugation (5,000 x g, 10 minutes, 4°C).

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 5% glycerol, and protease inhibitors.

  • Lyse cells using sonication or a French press.

  • Centrifuge at low speed (10,000 x g, 20 minutes, 4°C) to remove cell debris.

  • Ultracentrifuge the supernatant (100,000 x g, 1 hour, 4°C) to isolate membranes.

  • Solubilize membrane fraction with a gentle detergent (e.g., 1% n-dodecyl-β-D-maltoside).

  • Purify using affinity chromatography based on the chosen tag.

  • Further purify by size exclusion chromatography to obtain homogeneous protein.

Storage Conditions:
Based on the product information for recombinant CAB22R , the recommended storage conditions are:

  • Store in Tris-based buffer with 50% glycerol at -20°C.

  • For extended storage, conserve at -20°C or -80°C.

  • Avoid repeated freezing and thawing.

  • Working aliquots can be stored at 4°C for up to one week.

How can one effectively design mutations to study CAB22R function?

Designing mutations to study CAB22R function requires careful consideration of protein domains, conserved regions, and key amino acid residues. The following approaches are recommended:

Site-Directed Mutagenesis Strategies:

  • Target conserved regions: Focus on the two highly conserved regions identified in CAB proteins - the 28 amino acid sequence near the NH2-terminal and the 26 amino acid sequence in the middle of the protein . These regions likely have crucial functional roles.

  • Chlorophyll-binding residues: Target specific amino acid residues known to be involved in chlorophyll binding. Typically, these include histidine, glutamine, and glutamate residues that coordinate with the magnesium atom of chlorophyll.

  • Transmembrane domain alterations: Modify amino acids within predicted transmembrane helices to understand their role in membrane integration and protein stability.

  • Protein-protein interaction interfaces: Identify and mutate residues likely involved in interactions with other components of the light-harvesting complex.

Mutation Types to Consider:

  • Alanine scanning: Systematically replace amino acids with alanine to identify essential residues without introducing significant structural changes.

  • Conservative substitutions: Replace amino acids with others having similar properties to understand the importance of specific chemical characteristics.

  • Non-conservative substitutions: Replace amino acids with others having different properties to drastically alter function.

  • Deletion mutations: Create truncated versions of the protein to identify minimal functional domains.

Experimental Validation Methods:

  • In vitro reconstitution: Express mutant proteins and reconstitute with pigments to assess chlorophyll binding capacity.

  • Spectroscopic analysis: Use absorption and fluorescence spectroscopy to examine changes in pigment binding and energy transfer.

  • Circular dichroism: Assess changes in protein secondary structure resulting from mutations.

  • Functional complementation: Express mutant versions in CAB-deficient plants to assess functional rescue.

Mutation StrategyTarget RegionExpected OutcomeValidation Method
Alanine scanningConserved 28aa NH2-terminal regionIdentify essential residues for functionSpectroscopic analysis
His/Gln/Glu substitutionsPredicted chlorophyll-binding sitesAltered pigment bindingAbsorption spectroscopy
Conservative substitutionsTransmembrane domainsSubtle changes in membrane integrationCircular dichroism
Domain deletionsVarious regionsIdentify minimal functional unitsFunctional complementation

When designing mutations based on the promoter studies of CAB22R, researchers should consider:

  • GATA box modifications: Create specific nucleotide changes in the GATA box elements between the TATA and CAAT boxes to further understand their role in light-regulated expression .

  • CAAT box alterations: Design specific mutations in the CAAT box to examine its quantitative effect on transcript levels .

  • Target the -92 to -145 region: Create specific mutations or smaller deletions within this critical 52 bp region to identify the exact sequences responsible for the 20-fold reduction in transcript levels .

How does light intensity affect CAB22R expression patterns?

The expression of chlorophyll a/b binding proteins, including CAB22R, is highly responsive to light conditions, making this an important area for advanced research. While light regulation of transcription is a complex process involving multiple photoreceptors and signaling pathways , the following methodological approaches can be used to specifically study CAB22R responses:

Experimental Approaches to Study Light-Intensity Effects:

  • Quantitative RT-PCR Analysis:

    • Grow Petunia plants under different light intensities (e.g., 50, 100, 200, 500, 1000 μmol photons m⁻² s⁻¹)

    • Extract RNA from leaf tissue at consistent times to control for circadian effects

    • Perform qRT-PCR to quantify CAB22R transcript levels

    • Normalize expression to appropriate reference genes unaffected by light conditions

  • Time-Course Analysis:

    • Subject plants to shifts in light intensity and collect samples at multiple time points

    • Determine both the magnitude and kinetics of CAB22R expression changes

    • Compare with other light-regulated genes to identify shared and unique response patterns

  • Promoter-Reporter Fusion Studies:

    • Create transgenic plants with CAB22R promoter fused to reporter genes (GFP, LUC)

    • Visualize expression patterns under varying light intensities

    • Quantify reporter activity to correlate light intensity with promoter strength

  • Chromatin Immunoprecipitation (ChIP):

    • Identify light-responsive transcription factors that bind the CAB22R promoter

    • Perform ChIP under different light conditions to quantify binding

    • Correlate transcription factor binding with expression levels

Expected Response Patterns and Analysis Framework:

Light-regulated genes typically show complex response patterns that might include:

Light IntensityExpected ResponseBiological Significance
DarkMinimal expressionEnergy conservation
Low light (50-100 μmol m⁻² s⁻¹)Moderate expressionOptimize light capture in limiting conditions
Moderate light (200-500 μmol m⁻² s⁻¹)Maximal expressionOptimal photosynthetic efficiency
High light (>1000 μmol m⁻² s⁻¹)Decreased expressionPhotoprotection mechanism

The abundance of over 100 mRNAs is regulated by light, and at least three photoreceptors influence transcription, but the importance of each photoreceptor may vary from gene to gene . Understanding how CAB22R expression responds to different light intensities will provide insights into the adaptive mechanisms plants use to optimize photosynthetic efficiency across varying environmental conditions.

What methods can be used to investigate protein-protein interactions involving CAB22R?

Investigating protein-protein interactions (PPIs) involving CAB22R is crucial for understanding its functional role within the light-harvesting complex and potentially identifying novel interacting partners. The following methodological approaches are recommended for comprehensive PPI analysis:

In Vitro Methods:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies specific to CAB22R or use tagged recombinant protein

    • Isolate thylakoid membranes from Petunia chloroplasts

    • Solubilize membranes with mild detergents

    • Immunoprecipitate CAB22R and identify co-precipitating proteins by mass spectrometry

    • Include appropriate controls to identify non-specific interactions

  • Pull-down Assays:

    • Express tagged recombinant CAB22R in an appropriate system

    • Immobilize purified protein on affinity resin

    • Incubate with chloroplast or thylakoid membrane extracts

    • Elute bound proteins and identify by mass spectrometry

    • Compare results with control pull-downs using unrelated proteins

  • Crosslinking Coupled with Mass Spectrometry:

    • Treat isolated thylakoid membranes with chemical crosslinkers (e.g., DSP, BS3)

    • Digest crosslinked complexes with proteases

    • Analyze by liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Identify crosslinked peptides using specialized software

    • Map interaction interfaces at the amino acid level

In Vivo Methods:

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion proteins of CAB22R and potential partners with appropriate fluorophores

    • Express in plant protoplasts or suitable experimental system

    • Measure energy transfer efficiency using fluorescence microscopy

    • Calculate FRET efficiency to quantify interaction strength

    • Perform controls with non-interacting proteins

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse CAB22R and candidate interactors with complementary fragments of fluorescent proteins

    • Express in plant cells or protoplasts

    • Visualize reconstituted fluorescence using confocal microscopy

    • Map subcellular localization of interactions

    • Quantify fluorescence intensity to estimate interaction strength

  • Proximity-dependent Biotin Identification (BioID) or APEX2:

    • Fuse CAB22R with a biotin ligase (BioID) or peroxidase (APEX2)

    • Express in plant cells

    • Allow promiscuous biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Construct spatial interaction maps within the chloroplast

Data Analysis and Validation:

MethodAdvantagesLimitationsValidation Approach
Co-IP/Pull-downDirect physical interactionMay not preserve weak interactionsReciprocal pull-downs
Crosslinking-MSCaptures transient interactionsComplex data analysisTargeted mutagenesis of crosslinked residues
FRET/BiFCIn vivo visualizationPotential artifacts from overexpressionFRET efficiency measurements
BioID/APEX2Maps spatial proteomeIdentifies proximity not just direct interactionOrthogonal confirmation with Co-IP

This multi-method approach will provide a comprehensive understanding of the CAB22R interactome and its functional significance in photosynthetic light harvesting.

What are common challenges in expressing recombinant CAB22R?

Expressing recombinant CAB22R presents several challenges due to its nature as a chloroplastic membrane protein that normally binds pigments and forms part of a multi-protein complex. Researchers commonly encounter the following issues and should consider these troubleshooting approaches:

Challenge 1: Low Expression Levels

Potential causes and solutions:

  • Codon bias: CAB22R from Petunia contains codons that may be rare in common expression hosts.

    • Solution: Optimize codons for the expression host or use strains supplemented with rare tRNAs.

    • Alternative: Use expression hosts more closely related to plants, such as algal systems.

  • Promoter strength and induction conditions:

    • Solution: Test different promoters (T7, tac, AOX1) depending on the expression system.

    • Alternative: Optimize induction parameters (inducer concentration, temperature, duration).

  • mRNA stability:

    • Solution: Check for presence of sequences that might destabilize mRNA in the expression host.

    • Alternative: Include stabilizing elements in the expression construct.

Challenge 2: Protein Misfolding and Inclusion Body Formation

Potential causes and solutions:

  • Absence of chlorophyll binding partners:

    • Solution: Co-express with chlorophyll biosynthesis genes or reconstitute with pigments post-purification.

    • Alternative: Express as a fusion with solubility-enhancing partners (MBP, SUMO, etc.).

  • Membrane protein expression issues:

    • Solution: Use specialized strains designed for membrane protein expression (C41, C43).

    • Alternative: Lower induction temperature (16-20°C) and inducer concentration.

Challenge 3: Protein Instability

Potential causes and solutions:

  • Proteolytic degradation:

    • Solution: Use protease-deficient strains or add protease inhibitors during purification.

    • Alternative: Identify and modify protease-sensitive sites through mutagenesis.

  • Aggregation during purification:

    • Solution: Optimize detergent type and concentration for membrane solubilization.

    • Alternative: Include stabilizing additives (glycerol, specific lipids) in purification buffers.

  • Loss of structural integrity:

    • Solution: Maintain protein in Tris-based buffer with 50% glycerol as recommended .

    • Alternative: Avoid repeated freeze-thaw cycles and store working aliquots at 4°C.

Troubleshooting Decision Tree:

ObservationPrimary ApproachSecondary ApproachValidation Method
No detectable expressionChange expression systemOptimize codon usageWestern blot with tag-specific antibodies
Expression but insolubleLower induction temperatureAdd solubility enhancersSolubility fractionation analysis
Soluble but unstableAdd stabilizing compoundsIdentify degradation pointsThermal shift assays
Poorly functional proteinCo-express with interaction partnersReconstitute with pigmentsAbsorption spectroscopy

How can researchers address inconsistencies in CAB22R functional assays?

Functional assays for CAB22R may yield inconsistent results due to various factors including experimental conditions, sample preparation, and inherent biological variability. Addressing these inconsistencies requires systematic troubleshooting and standardization approaches:

Common Sources of Inconsistency and Remediation Strategies:

Variable Pigment Binding Properties

Problem: Inconsistent chlorophyll binding measured by spectroscopic methods.

Remediation strategies:

  • Standardize pigment:protein ratios during reconstitution experiments

  • Control light exposure of samples to prevent photobleaching

  • Establish strict temperature control during measurements

  • Develop internal standards for normalization between experiments

  • Compare absorption spectra across multiple wavelengths rather than single points

Variability in Promoter Analysis Results

Problem: Inconsistent effects of mutations on CAB22R promoter activity .

Remediation strategies:

  • Ensure consistent plant growth conditions prior to promoter activity assays

  • Control for position effects in transgenic plants by analyzing multiple independent lines

  • Normalize promoter activity to internal controls

  • Consider developmental stage and tissue type in reporter gene assays

  • Implement statistical approaches for identifying outliers

Inconsistent Protein-Protein Interaction Results

Problem: Variable detection of interaction partners across experiments.

Remediation strategies:

  • Standardize detergent types and concentrations for membrane solubilization

  • Control for expression levels of bait and prey proteins

  • Implement quantitative approaches (e.g., quantitative FRET, SPR)

  • Use multiple orthogonal assay methods for confirmation

  • Include appropriate positive and negative controls in each experiment

Statistical Approaches for Addressing Inconsistencies:

  • Increase biological replicates: Perform sufficient biological replicates (minimum n=3, preferably n≥5) to account for natural variation.

  • Apply appropriate statistical tests: Use ANOVA with post-hoc tests for comparing multiple conditions, or t-tests with correction for multiple comparisons.

  • Power analysis: Conduct power analysis to determine the sample size needed to detect biologically meaningful differences.

  • Control for batch effects: Implement batch correction methods in statistical analysis when experiments cannot be performed simultaneously.

Standardization Framework:

Assay TypeKey Variables to ControlRecommended StandardsValidation Method
Chlorophyll bindingTemperature, pH, light exposureChlorophyll:protein ratio standardsAbsorption spectra comparison
Promoter activityGrowth conditions, developmental stageInternal reference promotersqRT-PCR correlation
Protein-protein interactionsDetergent type, protein concentrationsKnown interaction pair controlsReciprocal confirmation
Expression analysisRNA quality, reference genesStandardized extraction protocolRT-qPCR validation

By implementing these structured approaches to troubleshooting and standardization, researchers can minimize inconsistencies in CAB22R functional assays and generate more reliable, reproducible data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.