Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB25; Chlorophyll a-b binding protein 25, chloroplastic; LHCII type I CAB-25; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-266
Protein Length
Full Length of Mature Protein
Species
Petunia sp. (Petunia)
Target Names
CAB25
Target Protein Sequence
RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Petunia sp. Chlorophyll a-b binding protein 25 (CAB25) and what is its primary function?

CAB25 is a member of the light-harvesting chlorophyll a/b-binding protein family in Petunia species. Its primary function is to collect and transfer light energy to photosynthetic reaction centers. In Petunia, the chlorophyll a/b binding protein genes have been classified into small multigene families based on nucleotide sequence homology . CAB25 specifically belongs to the external antenna proteins of Photosystem II and plays a crucial role in light absorption during photosynthesis .

The protein contains a typical CAB domain that includes binding sites for chlorophyll molecules and functions as part of the light-harvesting complex . As demonstrated in studies with other CAB proteins, it serves as a target for physiological regulation in plant photosystem II, allowing chloroplasts to respond flexibly to environmental conditions .

How is CAB25 gene expression regulated in Petunia plants?

The expression of CAB25 in Petunia is regulated through multiple mechanisms:

  • Transcriptional regulation: The gene contains typical eukaryotic promoter elements including TATA and CCAAT boxes. Additionally, genes expressed in leaf tissue contain an extensive region of homology (48 nucleotides) centered approximately 130 nucleotides from the transcription start sites .

  • Light-dependent regulation: Like other CAB genes, CAB25 expression is regulated by light. Studies on CAB gene family members show that their expression can be significantly affected by light conditions, with many showing upregulation in response to light exposure .

  • Environmental stress response: Environmental stresses directly or indirectly affect photosynthesis processes, including CAB protein expression. Research has shown that different CAB genes respond differently to various stresses; some may be inhibited while others are upregulated under specific stress conditions .

  • Post-translational regulation: Structural analyses show that CAB proteins contain various domains that can be targets for physiological regulation, including phosphorylation/dephosphorylation sites, suggesting regulation at the protein level enables chloroplasts to respond rapidly to environmental conditions .

A comprehensive study of CAB genes in tea plants (which provides insights applicable to Petunia) showed differential expression patterns under various stresses:

Stress ConditionExpression Response in Different CAB Genes
Cold stressSome CAB genes upregulated, others inhibited
ABA treatmentVariable responses among CAB family members
Heat stressMostly inhibited expression
DroughtVariable responses among CAB family members
Salt stressVariable responses among CAB family members
Light intensity changesSignificant differential regulation

This suggests that CAB25 regulation in Petunia likely involves complex environmental sensing mechanisms tailored to optimize photosynthetic efficiency under changing conditions .

What are the most effective expression systems for producing recombinant Petunia CAB25?

Based on research with similar chloroplast proteins, the following expression systems have proven effective:

  • Bacterial expression systems:

    • E. coli BL21(DE3) with pET vectors has been successfully used for CAB protein expression

    • Optimal induction conditions: 0.5-1.0 mM IPTG, 16-18°C overnight induction to minimize inclusion body formation

    • Addition of chlorophyll precursors can enhance proper folding

  • Chloroplast transformation in microalgae:

    • Chlamydomonas reinhardtii and Chlorella vulgaris have been developed as systems for chloroplast protein expression

    • Transformation via electroporation using species-specific vectors with endogenous recombination regions

    • Selection typically using antibiotic resistance markers such as kanamycin

  • Plant-based expression:

    • Transient expression in tobacco or petunia leaf protoplasts using CaMV 35S promoter

    • Stable transformation of Petunia plants via Agrobacterium-mediated transformation

    • Selection using kanamycin resistance genes

For recombinant CAB25 production, a chloroplast expression vector such as pCMCC (specifically designed for chloroplast transformation) has shown success with similar proteins. This vector includes:

  • Endogenous recombination regions (16S-trnI and trnA-23S)

  • The Prrn promoter

  • A selectable marker gene (typically Aph6 conferring kanamycin resistance)

Transformation efficiency with electroporation was improved using carbohydrate-based buffers containing 0.2 M mannitol, 0.2 M sorbitol, 0.08 M KCl, 0.005 M CaCl₂, and 0.01 M HEPES (pH 7.2) .

How can researchers optimize chlorophyll binding to recombinant CAB25 in vitro?

Optimizing chlorophyll binding to recombinant CAB25 requires careful consideration of several factors:

  • Protein reconstitution protocol:

    • Purify recombinant CAB25 in the presence of mild detergents (0.05% β-DM or 0.1% LDAO)

    • Mix with chlorophyll a and b at a molar ratio of 4:3 (reflecting natural binding preferences)

    • Incubate in buffer containing 50 mM Tris-HCl pH 7.5, 12.5% sucrose, 100 mM NaCl

  • Critical factors affecting binding efficiency:

    • Temperature (optimal at 4°C for at least 30 minutes)

    • pH (optimal range 7.0-7.5)

    • Ionic strength (100-150 mM NaCl)

    • Presence of lipids (particularly 1,2-dipalmitoyl-phosphatidyl-glycerole)

  • Assessment methods:

    • Absorption spectroscopy (characteristic peaks at ~430 nm and ~670 nm)

    • Fluorescence spectroscopy (emission maximum at ~680 nm)

    • Circular dichroism to verify proper protein folding

    • Size exclusion chromatography to confirm complex formation

Recent approaches have leveraged the naturally occurring binding interactions by incorporating synthetic membrane scaffolds. This method has shown a 60-85% binding efficiency compared to the 30-45% typically achieved with traditional reconstitution methods .

What methods are most effective for studying CAB25 function in photosynthetic processes?

Researchers employ multiple complementary approaches to study CAB25 function:

  • Genetic approaches:

    • VIGS (Virus-Induced Gene Silencing) to suppress CAB25 expression

    • CRISPR-Cas9 gene editing to create targeted mutations

    • Transgenic overexpression using constitutive promoters

  • Biochemical and biophysical methods:

    • Time-resolved fluorescence spectroscopy to measure energy transfer rates

    • Electron paramagnetic resonance (EPR) to analyze protein-pigment interactions

    • Native gel electrophoresis to study complex formation with other photosystem components

  • Structure-function analysis:

    • Site-directed mutagenesis of conserved residues

    • Cryo-electron microscopy of assembled photosystem complexes

    • X-ray crystallography for high-resolution structural analysis

  • Proteomics approaches:

    • iTRAQ (Isobaric Tags for Relative and Absolute Quantification) to measure protein abundance changes

    • Immunoprecipitation to identify interaction partners

    • Phosphoproteomics to identify regulatory modifications

A particularly effective approach combines VIGS-mediated suppression with proteome analysis. For example, researchers demonstrated that silencing of PhDHS (a gene involved in chloroplast development) reduced chlorophyll levels and affected proteins involved in photosystem I and II, including CAB proteins. Western blotting with antibodies against specific proteins confirmed the proteome analysis results, providing a powerful methodology for functional studies .

How do environmental stresses affect CAB25 expression and function?

Environmental stresses significantly impact CAB25 expression and function through multiple mechanisms:

  • Stress-induced expression changes:
    Studies in tea plants revealed that CAB gene expression is regulated differently under various stresses:

    • CsCP1 (similar to CAB25) expression was inhibited under six different stresses

    • CsCP2 expression was slightly upregulated only after cold stress and ABA treatment

    • Other CAB family members (CSA016997 and CSA030476) were significantly upregulated under all six stresses

    This suggests that CAB25 in Petunia may also show stress-specific expression patterns.

  • Protein phosphorylation state:
    CAB proteins contain phosphorylation sites that can be modified in response to stress:

    • Protein kinase C phosphorylation sites are present in many CAB proteins

    • Phosphorylation/dephosphorylation appears to be a main form of regulation

    • GTP-mediated signaling may also regulate CAB protein function

  • Observed physiological effects:
    Plants with altered CAB expression show specific phenotypes under stress:

    • amiLhcb1 plants (lacking a key LHCII protein) grew more slowly than wild type and had paler leaves

    • Under fluctuating light conditions (50 μmol photons m⁻² s⁻¹ interrupted by 500 μmol photons m⁻² s⁻¹ peaks), both amiLhcb1 and amiLhcb2 plants showed stunted growth

These findings suggest that CAB25 likely serves as a pivotal regulatory site of photosynthesis, allowing plants to modulate light harvesting in response to environmental challenges .

What are the structural determinants of chlorophyll binding specificity in CAB25?

The chlorophyll binding specificity of CAB25 is determined by several key structural features:

  • Conserved binding domains:

    • Two regions within mature CAB proteins are highly conserved across all genes: a sequence of 28 amino acids near the N-terminal and another sequence of 26 amino acids in the middle of the protein

    • These domains contain specific residues that coordinate with the magnesium center of chlorophyll molecules

  • Internal repeats:

    • CAB proteins contain two internal repeats (in Petunia, these are located at residues 105-140 and 216-251)

    • The identity between these two internal repeats is approximately 44%

    • This structural feature reflects the evolutionary history of these proteins and contributes to their ability to bind multiple chlorophyll molecules

  • Specific binding residues:
    Recent studies of designed de novo proteins housing chlorophyll molecules have identified critical features:

    • Histidine residues are essential for coordinating with the central Mg²⁺ of chlorophyll

    • Hydrophobic residues create a binding pocket that accommodates the chlorophyll porphyrin ring

    • The protein's secondary structure (primarily α-helical) creates the proper geometry for chlorophyll binding

  • Excitonic coupling determinants:
    The precise orientation of bound chlorophylls is critical for function:

    • C₂-symmetric protein arrangements can hold two chlorophyll molecules in specific geometries

    • X-ray crystallography has confirmed that designed proteins can bind chlorophylls in the same orientation as native special pairs

    • These structural arrangements facilitate excitonic coupling between chlorophyll molecules

Understanding these structural determinants has enabled researchers to design artificial proteins that bind chlorophyll molecules in predetermined orientations, demonstrating that de novo design of photosynthetic systems is becoming feasible .

How does CAB25 compare with homologous proteins across different plant species?

CAB25 from Petunia shares significant homology with chlorophyll binding proteins from multiple plant species:

  • Sequence homology:
    Homologous sequences of CAB proteins exhibit varying degrees of similarity:

    • Sequence identities between Petunia CAB proteins and those from Jatropha curcas, Citrus sinensis, Vitis vinifera, and Eucalyptus grandis exceed 76%

    • Total alignment scores greater than 440 indicate high conservation

    • Surprisingly, one study found that the sequence of a Petunia CAB protein was completely identical to a hypothetical protein (WP_039310936) in Paenibacillus sp. IHB B 3415, raising interesting evolutionary questions

  • Functional conservation:
    Despite sequence variations, key functional domains remain highly conserved:

    • Transit peptide sequences are more divergent than mature peptide sequences

    • The chlorophyll-binding domains show the highest conservation

    • Regulatory domains may differ, reflecting species-specific adaptation to different light environments

  • Evolutionary relationships:
    Phylogenetic analysis of CAB proteins reveals:

    • Clear clustering by protein type (LHCI vs. LHCII)

    • Taxonomic grouping within each functional class

    • Evidence of gene duplication and divergence events

The table below summarizes comparisons between Petunia CAB25 and homologous proteins from other plant species:

SpeciesProtein IDSequence Identity (%)Similarity (%)Key Structural Differences
Jatropha curcasXP_012072637.1>76>85Minor variations in transit peptide
Citrus sinensisXP_006478298.1>76>85Similar core structure
Vitis viniferaXP_002264295.1>76>85Variations in N-terminal region
Eucalyptus grandisXP_010063732.1>76>85Conserved binding domains
Paenibacillus sp.WP_039310936100100Identical sequence (unusual finding)
Arabidopsis thaliana-~60-70~75-85Variations in regulatory domains

This high conservation across diverse plant species highlights the fundamental importance of CAB proteins in photosynthesis and suggests strong selective pressure to maintain their function .

What genome engineering approaches can be used to modify CAB25 expression in Petunia?

Several genome engineering approaches have been successfully employed to modify CAB gene expression in Petunia and can be applied to CAB25:

  • VIGS (Virus-Induced Gene Silencing):

    • Effective for transient suppression of target genes

    • The pTRV2 vector system has been successfully used in Petunia

    • Allows rapid assessment of phenotypic effects without stable transformation

  • RNAi-based approaches:

    • Antisense and sense suppression constructs for gene silencing

    • RNAi constructs (pSPB538) have shown superior efficiency compared to antisense approaches (pSPB520)

    • Can achieve up to 65 out of 84 transgenic plants with altered phenotypes (77% efficiency)

  • T-DNA integration:

    • Integration near scaffold/matrix attachment regions (S/MARs) can affect gene expression

    • T-DNA preferentially integrates at the borders of S/MARs rather than in their centers

    • Small rearrangements typically occur during T-DNA integration

  • Chloroplast transformation:

    • Species-specific vectors with endogenous recombination regions (such as pCMCC)

    • Transformation via electroporation using carbohydrate-based buffers

    • Selection using antibiotic resistance markers (typically kanamycin)

  • CRISPR-Cas9 gene editing:

    • Allows precise targeted modifications

    • Can be used to create knockout mutations or specific sequence alterations

    • The recently available chromosome-level genome assembly of Petunia facilitates guide RNA design

What are the major technical challenges in studying CAB25 function?

Researchers face several technical challenges when studying CAB25 function:

  • Protein stability and reconstitution:

    • Chlorophyll binding proteins are highly hydrophobic and tend to aggregate

    • Maintaining native structure during purification requires careful detergent selection

    • Reconstituting the protein-pigment complex with the correct stoichiometry is technically demanding

  • Redundancy in the CAB gene family:

    • Multiple family members with overlapping functions complicate functional studies

    • The Petunia genome contains at least 16 genes encoding chlorophyll a/b binding proteins

    • Complete gene family characterization is necessary to understand individual gene functions

  • Transient vs. stable phenotypes:

    • Transgenic plants can show unstable phenotypes over time

    • Some lines exhibit variable phenotypic expression after several years in greenhouses

    • Maintaining tissue culture stock is necessary to preserve modified characteristics

  • Complex regulatory networks:

    • CAB gene expression is regulated by multiple factors including light, developmental stage, and stress

    • Distinguishing direct from indirect effects requires sophisticated experimental designs

    • Systems biology approaches are needed to understand the regulatory networks

What are emerging technologies for studying CAB25's role in photosynthesis?

Several emerging technologies are advancing our understanding of CAB proteins:

  • Single-molecule spectroscopy:

    • Allows observation of energy transfer events in individual protein complexes

    • Reveals heterogeneity in function that is masked in ensemble measurements

    • Provides insights into the dynamics of energy transfer processes

  • Cryo-electron microscopy:

    • Recent advances allow visualization of protein-pigment complexes at near-atomic resolution

    • Has been successfully applied to designed protein nanocages containing 24 chlorophyll molecules

    • Enables verification of structural models against experimental data

  • Computational protein design:

    • De novo design of proteins that bind chlorophyll molecules in predetermined orientations

    • Creates artificial photosynthetic systems with tailored properties

    • Provides a platform for testing structure-function hypotheses

  • Machine learning applications:

    • ML algorithms can optimize callogenesis in petunia tissue culture

    • GRNN (Generalized Regression Neural Network) models have shown superior performance (R²≥83%)

    • Integration with genetic algorithms can optimize phytohormone concentrations for tissue culture

  • Genome-wide association studies (GWAS):

    • The availability of high-quality genome assemblies enables association studies

    • Can identify natural variations in CAB genes associated with photosynthetic efficiency

    • Five SNPs in Lhcb1 (a CAB gene) were significantly associated with agronomic traits including plant height, spike length, grain characteristics, and leaf color

These emerging technologies promise to deepen our understanding of CAB25's role in photosynthesis and may lead to applications in improving plant productivity and resilience.

How might CAB25 research contribute to improving photosynthetic efficiency in crops?

Research on CAB25 and related proteins has significant potential to improve crop photosynthetic efficiency:

By advancing our understanding of these fundamental components of the photosynthetic apparatus, CAB25 research contributes to the broader goal of improving crop productivity to meet growing global food demands.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.