Recombinant Petunia sp. Chlorophyll a-b binding protein 91R, chloroplastic (CAB91R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB91R; Chlorophyll a-b binding protein 91R, chloroplastic; LHCII type I CAB-91R; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Petunia sp. (Petunia)
Target Names
CAB91R
Target Protein Sequence
RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary structure of Petunia Chlorophyll a-b binding protein 91R?

The Petunia Chlorophyll a-b binding protein 91R belongs to a family of proteins encoded by multiple genes in Petunia species. The protein is synthesized as a precursor of approximately 32,000 daltons with an open reading frame consisting of 266-267 amino acids . The mature protein undergoes post-translational modification where a transit peptide of 34-36 amino acids is cleaved from the NH2-terminal region . The protein contains two highly conserved regions that are crucial for its function: a 28-amino acid sequence near the NH2-terminal and a 26-amino acid sequence in the middle portion of the protein . These conserved regions are likely involved in chlorophyll binding and thylakoid membrane integration.

How does the genomic organization of CAB91R compare to other Chlorophyll a-b binding proteins in Petunia?

The CAB91R gene belongs to one of the multiple gene families encoding Chlorophyll a-b binding proteins in Petunia. Research has identified at least 16 genes in Petunia (Mitchell) that encode chlorophyll a/b binding proteins, which have been classified into small multigene families based on nucleotide sequence homology . These gene families share similar structural features but differ in specific sequence elements. The promoter regions of these genes contain typical eukaryotic promoter elements including TATA and CCAAT boxes . Additionally, genes expressed in petunia leaf tissue, like CAB91R, contain an extensive region of homology approximately 130 nucleotides from the transcription start sites .

How is the expression of CAB91R regulated in response to light conditions?

The expression of Chlorophyll a-b binding proteins, including CAB91R, is primarily regulated by light conditions through a complex signaling network. When designing experiments to study CAB91R expression, researchers should implement a controlled light exposure protocol with defined light intensity, duration, and spectral quality. Quantitative PCR (qPCR) methodologies should include:

  • Collection of plant tissue samples at multiple time points after light exposure

  • RNA extraction using RNase-free conditions

  • cDNA synthesis with consistent reverse transcription protocols

  • qPCR amplification using primers specific to the conserved regions of the CAB91R gene

  • Normalization against multiple reference genes that maintain stable expression under varying light conditions

The analysis should incorporate time-course measurements to detect temporal patterns in expression levels, with statistical comparison between different light treatments.

What experimental approaches can be used to study the promoter elements governing CAB91R expression?

To investigate the promoter elements controlling CAB91R expression, researchers should employ a systematic approach combining in silico analysis with experimental validation. The methodology should include:

  • Computational identification of conserved regulatory motifs within the 48-nucleotide homology region located approximately 130 nucleotides upstream of the transcription start site

  • Generation of a series of promoter deletion constructs fused to reporter genes (e.g., GFP, LUC)

  • Site-directed mutagenesis of specific promoter elements including the TATA and CCAAT boxes

  • Transient expression assays in protoplasts or stable transformation of model plants

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter region

What methodologies are most effective for studying interactions between CAB91R and other photosystem components?

Investigating protein-protein interactions involving CAB91R requires multiple complementary approaches to generate reliable data. Recommended methodologies include:

  • Co-immunoprecipitation (Co-IP) with antibodies specific to CAB91R or epitope-tagged versions

  • Yeast two-hybrid screening using the conserved regions as bait sequences

  • Bimolecular fluorescence complementation (BiFC) for in vivo visualization of interactions

  • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

For data validation, researchers should implement controls for each method:

MethodologyPositive ControlNegative ControlData Validation Metric
Co-IPKnown interacting proteinNon-interacting proteinSignal-to-noise ratio
Y2HKnown interaction pairEmpty vectorGrowth on selective media
BiFCKnown interaction pairNon-interacting pairFluorescence intensity
SPRConcentration gradientUnrelated proteinBinding affinity (Kd)
BioIDKnown proximal proteinCytosolic proteinEnrichment factor

When analyzing interaction data, researchers should cross-validate findings using at least two independent methods to minimize method-specific artifacts.

What expression systems are optimal for producing functional recombinant CAB91R protein?

The production of functional recombinant CAB91R presents significant challenges due to its membrane association and requirement for chlorophyll binding. When designing an expression system, researchers should consider:

  • E. coli-based expression:

    • Use of specialized strains (Rosetta, Origami) for proper folding

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Co-expression with chlorophyll biosynthesis genes

    • Expression conditions: low temperature (16-18°C), reduced inducer concentration

  • Eukaryotic expression systems:

    • Insect cell-based systems (Sf9, High Five)

    • Plant-based expression (tobacco BY-2 cells, Arabidopsis)

    • Chloroplast transformation systems for proper localization

  • Cell-free expression:

    • Using chloroplast extracts to provide native folding environment

    • Supplementation with chlorophyll and lipid components

A comparison of protein yields and functionality between systems should be conducted:

Expression SystemAdvantagesLimitationsTypical Yield (mg/L)Functional Assessment Method
E. coliRapid, inexpensiveImproper folding5-15Spectroscopic analysis
Insect cellsPost-translational modificationsHigher cost2-10Chlorophyll binding assay
Plant cellsNative environmentTime-consuming0.5-5In vivo localization
Cell-freeRapid, scalableHigher cost0.1-2Energy transfer efficiency

What purification strategies provide the highest yield of functional CAB91R?

Purification of membrane-associated proteins like CAB91R requires specialized approaches. A comprehensive purification strategy should include:

  • Membrane fraction isolation using differential centrifugation

  • Detergent screening to identify optimal solubilization conditions:

    • Test multiple detergents (DDM, LMNG, digitonin)

    • Optimize detergent concentration and buffer components

  • Affinity chromatography using N- or C-terminal tags

  • Size exclusion chromatography to separate protein-pigment complexes

  • Quality control assessments:

    • Chlorophyll content analysis by spectroscopy

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays to evaluate protein folding

Researchers should implement a systematic optimization approach, testing variables sequentially while monitoring protein yield, purity, and functionality at each step.

What are the recommended approaches for solving the three-dimensional structure of CAB91R?

Determining the three-dimensional structure of CAB91R requires a multi-technique approach to overcome challenges associated with membrane proteins. The methodological workflow should include:

  • X-ray crystallography:

    • Lipidic cubic phase (LCP) crystallization

    • Detergent screening for crystal formation

    • Utilization of lipid bilayer mimetics (bicelles, nanodiscs)

    • Heavy atom derivatives for phase determination

  • Cryo-electron microscopy (Cryo-EM):

    • Single-particle analysis of detergent-solubilized protein

    • Preparation in nanodiscs or amphipols

    • Data collection strategies for small membrane proteins

    • 3D reconstruction and model building

  • Nuclear Magnetic Resonance (NMR):

    • Solution NMR of isolated domains

    • Solid-state NMR for membrane-embedded protein

    • Selective isotopic labeling (15N, 13C, 2H)

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations in membrane environment

    • Integrative modeling combining experimental constraints

The structural data should be validated using multiple complementary techniques and analyzed for conservation patterns in the two identified functional regions of the protein .

What experimental design is most effective for structure-function studies of the conserved regions in CAB91R?

Structure-function analysis of CAB91R should focus on the two highly conserved regions identified in chlorophyll a/b binding proteins: the 28-amino acid sequence near the NH2-terminal and the 26-amino acid sequence in the middle of the protein . An effective experimental design should include:

  • Site-directed mutagenesis strategy:

    • Alanine-scanning mutagenesis of conserved residues

    • Conservative and non-conservative substitutions

    • Domain swapping with related proteins

    • Deletion analysis of non-conserved regions

  • Functional assays:

    • Chlorophyll binding capacity measurements

    • Membrane integration efficiency

    • Energy transfer efficiency using fluorescence techniques

    • Protein stability assessments

  • In vivo analysis:

    • Complementation studies in knockout/knockdown lines

    • Chlorophyll fluorescence measurements (Fv/Fm, NPQ)

    • Physiological responses under varying light conditions

    • Protein-protein interaction analysis with photosystem components

The experimental design should incorporate appropriate controls and statistical analysis to determine the significance of observed phenotypic changes.

How can researchers detect and resolve contradictions in experimental data related to CAB91R function?

When conducting complex studies on CAB91R, researchers may encounter contradictory results across different experimental approaches. A systematic framework for handling data contradictions includes:

  • Contradiction detection strategies:

    • Cross-validation across multiple experimental methods

    • Statistical analysis to identify significant discrepancies

    • Literature comparison to identify inconsistencies with published data

  • Resolution approaches:

    • Identify potential sources of experimental variability

    • Implement controlled studies with standardized conditions

    • Evaluate whether contradictions reflect biological complexity rather than experimental error

  • Validation framework:

    • Independent replication by different researchers

    • Complementary methodologies to address the same question

    • Controls to rule out specific confounding factors

When encountering contradictions between datasets, researchers should systematically evaluate experimental conditions that might explain the discrepancies, including protein preparation methods, assay conditions, and biological context .

Type of ContradictionPotential CausesResolution StrategyValidation Approach
Protein localizationSample preparation differencesStandardize isolation protocolsMultiple localization techniques
Binding affinitiesBuffer conditions, protein modificationsSystematic parameter testingITC and SPR cross-validation
Expression patternsGrowth conditions, developmental stageTime-course studiesMultiple reference genes
Protein-protein interactionsDetergent effects, transient interactionsIn vivo validationOrthogonal interaction assays

What statistical approaches are most appropriate for analyzing CAB91R experimental data?

Researchers should implement appropriate experimental designs that allow for statistical validation, including sufficient biological and technical replicates, randomization, and blinding where applicable.

How can single-case experimental designs enhance CAB91R functional studies?

Single-case experimental designs can provide valuable insights into CAB91R function, particularly when working with specialized genetic lines or limited sample availability. Effective implementation includes:

  • Design selection and implementation:

    • ABAB designs for testing reversible interventions

    • Multiple baseline designs across different conditions

    • Alternating treatments design for comparing multiple interventions

  • Methodological considerations:

    • Establish stable baseline measurements before intervention

    • Implement randomization when possible to enhance scientific credibility

    • Include a minimum of three demonstrations of experimental effect

    • Design complex phase-change strategies for testing multiple components

  • Data analysis approaches:

    • Visual analysis of trend, level, and variability

    • Effect size calculations appropriate for single-case designs

    • Statistical techniques specifically developed for single-case research

Single-case designs are particularly valuable when studying the effects of specific mutations on CAB91R function, allowing for detailed analysis of individual variants rather than population-level effects.

What advanced techniques are emerging for studying the dynamics of CAB91R in photosynthetic membranes?

Recent methodological advances offer new opportunities for investigating the dynamics of CAB91R in photosynthetic membranes. Emerging techniques include:

  • Super-resolution microscopy approaches:

    • PALM/STORM imaging for nanoscale localization

    • FRET-based approaches for protein interaction dynamics

    • Single-molecule tracking to monitor protein mobility

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption spectroscopy

    • Time-correlated single-photon counting

    • 2D electronic spectroscopy for energy transfer dynamics

  • In situ structural techniques:

    • Cryo-electron tomography of chloroplast membranes

    • In-cell NMR approaches

    • Mass spectrometry imaging of intact membrane systems

  • Advanced computational methods:

    • Coarse-grained molecular dynamics simulations

    • Quantum mechanical calculations of energy transfer

    • Machine learning approaches for pattern recognition in complex datasets

These emerging techniques allow researchers to move beyond static structural studies to understand the dynamic behavior of CAB91R in its native environment, providing insights into functional mechanisms under physiologically relevant conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.