Recombinant Phaeodactylum tricornutum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-314
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
petA
Target Protein Sequence
YPVFAQQNYSNPRAANGKLACANCHLNQKAIEIEAPQAVLPNSIFEVEIKVPYDTTKQQL GANGKKADLNVGGILMLPEGFKLAPKNQIPAEVKEKNKGVFISPYSSEFDNILVVGPIAG KTHQELIFPVMAPDPEKNSDIKYLTYPFYAGGNRGRGQVYPTGEKSNVNVFGANQSGQIT EITVTEKGESTILILNSNGKQTSQVLPAGLILSIKQGQVVKADQPLNIDPNVGGFGQEES EIVLQNPIRIYGYLAFCFSVLITQIMLVLKKKQFEKVQAAELNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, it facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Phaeodactylum tricornutum and why is it used as a model organism for protein expression?

Phaeodactylum tricornutum is a marine unicellular diatom that has emerged as a prominent platform organism for metabolic engineering and synthetic biology. It possesses several characteristics that make it valuable for research:

  • Its genome sequence availability has facilitated the development of new bioengineering tools

  • It displays three distinct morphotypes (fusiform, triradiate, and oval) with unique metabolic properties

  • It has a cell wall poor in silica, making it easier to work with compared to other diatoms

  • It has been successfully utilized to produce heterologous proteins, such as the SARS-CoV-2 spike receptor-binding domain and plant-specialized metabolites

  • It features established genetic tools including genome editing with TALENs and CRISPR technologies

The availability of genome sequences for multiple accessions (Pt1-Pt10) has revealed genetic diversity that can be leveraged for different research purposes . As a chassis for producing high-value compounds, P. tricornutum is increasingly relevant for bioengineering applications, though its use remains in relatively early stages of development .

What is the function of Apocytochrome f (petA) in P. tricornutum?

Apocytochrome f is the precursor form of cytochrome f, encoded by the petA gene. In its mature form after heme attachment, cytochrome f functions as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. Its key functions include:

How is recombinant P. tricornutum Apocytochrome f typically expressed and purified?

Based on available research, the standard methodology for expressing and purifying recombinant P. tricornutum Apocytochrome f includes:

Expression system:

  • Primarily expressed in E. coli expression systems rather than in P. tricornutum itself

  • Typically expressed as a partial protein (amino acids 31-314) that excludes transmembrane domains to improve solubility

Expression construct features:

  • Inclusion of an N-terminal His-tag to facilitate purification

  • The full amino acid sequence: YPVFAQQNYSNPRAANGKLACANCHLNQKAIEIEAPQAVLPNSIFEVEIKVPYDTTKQQLGANGKKADLNVGGILMLPEGFKLAPKNQIPAEVKEKNKGVFISPYSSEFDNILVVGPIAGKTHQELIFPVMAPDPEKNSDIKYLTYPFYAGGNRGRGQVYPTGEKSNVNVFGANQSGQITEITVTEKGESTILILNSNGKQTSQVLPAGLILSIKQGQVVKADQPLNIDPNVGGFGQEESEIVLQNPIRIYGYLAFCFSVLITQIMLVLKKKQFEKVQAAELNF

Purification protocol:

  • Affinity chromatography using the His-tag

  • Storage in Tris-based buffer with 50% glycerol, pH 8.0

  • Recommended reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage at -20°C/-80°C with aliquoting to avoid freeze-thaw cycles

Quality control measures:

  • SDS-PAGE analysis to confirm purity (>90%)

  • Storage of working aliquots at 4°C for up to one week to maintain stability

What structural features are important for Apocytochrome f function?

Apocytochrome f possesses several crucial structural features that determine its function:

Key structural elements:

  • Contains specific cysteine residues that form the CXXCH motif essential for covalent heme attachment

  • Includes a single transmembrane domain that anchors the protein to the thylakoid membrane

  • Features a large lumenal domain responsible for electron transfer interactions

Maturation-related structures:

  • Has a cleavable N-terminal signal sequence that targets the protein to the thylakoid membrane

  • After signal sequence cleavage, the α-amino group of the N-terminal Tyr1 serves as an axial ligand for the heme

  • The C-terminal membrane anchor influences the rate of cytochrome f synthesis

These structural elements work together to ensure proper localization, heme attachment, and electron transfer function. Modifications to these regions through site-directed mutagenesis have demonstrated their importance for cytochrome f biogenesis and function .

How does the pre-apocytochrome f maturation process occur?

The maturation of pre-apocytochrome f involves several coordinated steps:

Sequential maturation process:

  • Translation of the petA gene produces pre-apocytochrome f containing an N-terminal signal sequence

  • The protein is targeted to the thylakoid membrane

  • A thylakoid processing peptidase cleaves the signal sequence (typically at an AQA consensus site)

  • The cysteine residues in the CXXCH motif must be maintained in a reduced state by thioredoxin-like proteins such as CCS5

  • A heme lyase catalyzes the covalent attachment of heme to the cysteine residues

  • The mature holocytochrome f is incorporated into the cytochrome b6f complex

Important research findings:

  • Heme binding is not a prerequisite for cytochrome f processing, as demonstrated by site-directed mutagenesis studies

  • Pre-apocytochrome f can adopt a suitable conformation for the cysteinyl residues to be substrates for the heme lyase

  • Both pre-apocytochrome f and pre-holocytochrome f can fold into assembly-competent conformations

  • The reduction of disulfide bonds in the CXXCH motif requires a pathway involving thioredoxin-like proteins

What factors affect proper folding and activity of recombinant Apocytochrome f in heterologous expression systems?

Multiple factors influence the successful production of functional recombinant Apocytochrome f:

Expression host considerations:

FactorImpact on ExpressionMitigation Strategy
Expression host selectionE. coli lacks specific cytochrome c maturation machineryConsider co-expression of cytochrome c maturation genes
Redox environmentImproper disulfide bond formation affects heme attachmentInclude reducing agents or thioredoxin in expression system
Protein solubilityTransmembrane domain causes aggregationUse truncated constructs (residues 31-314)
Cofactor availabilityHeme incorporation requires specific machinerySupplement growth medium with δ-aminolevulinic acid to increase heme production

Post-expression considerations:

  • Protein stability requires 50% glycerol in storage buffer

  • Repeated freeze-thaw cycles reduce protein activity

  • Working aliquots should be maintained at 4°C for maximum one week

Research indicates that protein yield and proper folding represent a tradeoff between E. coli systems (higher yield but potential folding issues) and expression in P. tricornutum (more authentic processing but typically lower yield) .

How can site-directed mutagenesis be used to study structure-function relationships in Apocytochrome f?

Site-directed mutagenesis provides valuable insights into Apocytochrome f function through systematic modification of key residues:

Strategic mutagenesis targets:

  • Heme-binding residues: Substituting cysteine residues in the CXXCH motif with valine and leucine demonstrated that heme binding is not required for protein processing

  • Signal peptide cleavage site: Replacing the AQA sequence with LQL resulted in delayed processing but still permitted heme binding and complex assembly

  • Membrane anchor region: Modification revealed its role in down-regulating cytochrome f synthesis rate

  • Electron transfer domains: Mutations can identify residues critical for interaction with electron transfer partners

Experimental workflow for structure-function studies:

  • Design mutations targeting specific functional domains

  • Perform chloroplast transformation with mutated constructs

  • Confirm transformants through selection markers

  • Analyze protein processing using Western blot and heme-staining procedures

  • Conduct pulse-chase experiments to monitor synthesis and degradation rates

  • Assess ability of mutant proteins to assemble into functional complexes

  • Measure photosynthetic electron transport rates to determine functional consequences

This approach has revealed that pre-apocytochrome f can adopt assembly-competent conformations even with significant modifications to key functional regions .

What is the role of thioredoxin-like proteins such as CCS5 in Apocytochrome f assembly?

Thioredoxin-like proteins play a crucial role in cytochrome f maturation by maintaining the proper redox environment:

CCS5 function in cytochrome maturation:

  • Provides reducing equivalents to the thylakoid lumen necessary for proper assembly of c-type cytochromes

  • Participates in disulfide-dithiol exchange reactions that maintain cysteine residues in a reduced state

  • Works within a pathway involving NADPH-dependent thioredoxin reductase, thioredoxin, CcdA/DsbD, and ResA/CcsX

Evidence supporting this role:

  • The ccs5 mutant can be rescued by exogenous thiols

  • CCS5 directly interacts with apocytochrome f in yeast two-hybrid assays

  • Molecular complementation of the ccs5 mutant strain restores cytochrome assembly

Mechanism of action:

  • CCS5 likely resides in the thylakoid membrane with its active site facing the lumen

  • It functions through sequential thiol-disulfide exchange reactions

  • This process maintains the cysteine residues of the CXXCH motif in a reduced state required for thioether bonds formation with heme

This research indicates that co-expression of CCS5 or similar thioredoxin-like proteins may enhance the production of properly assembled recombinant cytochrome f in heterologous systems.

How does Apocytochrome f expression differ between P. tricornutum morphotypes?

P. tricornutum displays three distinct morphotypes with significant differences in their proteomes:

Morphotype-specific characteristics:

MorphotypeDistinguishing Metabolic FeaturesPotential Impact on Apocytochrome f
Fusiform (reference)Baseline expression patternsUsed as standard for comparative studies
TriradiateUp-regulated oxido-reduction and glycolytic processes May affect electron transport chain components including cytochrome f
OvalDistinct metabolism with specific protein enrichment; altered purine and cellular amino acid metabolism May have unique post-translational modifications or processing of cytochrome f

Research implications:

  • The choice of morphotype may significantly impact studies of cytochrome f function

  • Comparative proteomic analyses between morphotypes reveal different protein expression patterns

  • Secretome analysis of each morphotype shows distinct extracellular protein profiles

These morphotype-specific differences highlight the importance of specifying which P. tricornutum variant is being used in research and considering how morphological differences might influence experimental results related to Apocytochrome f.

What techniques can be used to assess proper heme incorporation in recombinant Apocytochrome f?

Multiple analytical techniques can verify successful heme incorporation into recombinant Apocytochrome f:

Spectroscopic methods:

  • UV-visible absorption spectroscopy: Holocytochrome f shows characteristic absorption peaks at approximately 550 nm (α-band), 520 nm (β-band), and 410 nm (Soret band)

  • Resonance Raman spectroscopy: Provides information about heme iron coordination and spin state

Biochemical methods:

  • Heme-staining procedure: Reveals c-type cytochromes based on peroxidase activity of the heme group

  • Western blot analysis: Using antibodies specific for apocytochrome or holocytochrome forms

  • Size exclusion chromatography: The holo-form typically has a different elution profile compared to the apo-form

Functional assays:

  • Electron transfer activity measurements using artificial electron donors/acceptors

  • Redox potential determination through potentiometric titration

A comprehensive analysis would typically employ multiple complementary techniques to confirm both the presence and proper incorporation of the heme group, which is essential for the protein's electron transfer function.

How can random mutagenesis be used to generate P. tricornutum strains with altered Apocytochrome f properties?

Random mutagenesis provides a powerful approach for generating novel P. tricornutum variants with potentially enhanced properties:

Mutagenesis methods for P. tricornutum:

  • Non-ionizing mutagens: UV-C radiation and ethyl methanosulfonate (EMS)

  • Ionizing mutagen: X-ray irradiation (up to 1000 Grays)

Screening methodology:

  • Establish mortality curves using fluorescent cell dyes (LIVE/DEAD fixable Violet)

  • Implement high-throughput screening via fluorescence-activated cell sorting (FACS)

  • Sort single cells into 384-well microplates and allow recovery

  • Screen surviving colonies using spectral deconvolution

  • Perform high-performance liquid chromatography (HPLC) to quantify changes in target components

Important considerations:

  • Mutant phenotype stability must be assessed over time (e.g., 6 months)

  • P. tricornutum shows high rates of mitotic interhomolog recombination (>10× that of Saccharomyces cerevisiae)

  • Mutant populations typically display higher standard deviation in phenotype measurements compared to wild-type

  • Oxidative stress increases mitotic recombination in P. tricornutum

  • Ongoing sorting and screening may be necessary to maintain hyper-performing cultures

This approach could potentially identify strains with altered cytochrome f properties that might enhance electron transport efficiency or other desirable characteristics.

How can recombinant Apocytochrome f be used to study environmental stress responses in marine diatoms?

Recombinant Apocytochrome f provides a valuable tool for investigating how environmental stressors affect photosynthetic function in diatoms:

Applications in stress response studies:

  • Marker for photosynthetic efficiency:

    • Changes in cytochrome f expression and processing can indicate stress effects on electron transport

    • Antibodies against recombinant protein can monitor native protein levels under various stress conditions

  • Structure-function analysis:

    • Recombinant variants with specific mutations can help understand how environmental factors affect protein function

    • In vitro studies can determine direct impacts of stressors on protein stability and activity

  • Comparative analysis:

    • Comparing responses across different P. tricornutum accessions (Pt1-Pt10)

    • Evaluating effects of specific stressors like nitrogen limitation or pharmaceutical compounds

Research methodology:

  • Nitrogen stress studies using iTRAQ experiments to detect proteomic changes

  • Diclofenac exposure studies to investigate biotransformation pathways

  • Generation of mutant strains using various mutagenesis methods followed by screening for altered stress responses

These approaches can reveal how cytochrome f and the electron transport chain respond to environmental challenges, providing insights into diatom adaptation mechanisms and potentially identifying strains with enhanced stress tolerance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.