Recombinant Phaeodactylum tricornutum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Relevance

The recombinant Phaeodactylum tricornutum ATP synthase subunit b, chloroplastic (atpF), is a bioengineered protein derived from the diatom Phaeodactylum tricornutum. It represents the peripheral stalk subunit b of the chloroplast ATP synthase, a critical enzyme in photosynthesis responsible for ATP synthesis via proton translocation across the thylakoid membrane . This subunit interacts with other components (e.g., subunit b′, atpE, atpB) to stabilize the enzyme’s structure and regulate its activity .

Expression System

The recombinant protein is heterologously expressed in E. coli, leveraging bacterial systems for scalable production. The gene construct includes a promoter (e.g., HASP1) and terminator (e.g., FcpA) for optimal expression .

Purification and Yield

  • Method: SDS-PAGE-validated purification ensures >85% purity .

  • Yield: Not explicitly quantified, but typical bacterial expression systems achieve milligram-scale yields .

Potential Uses

  1. Structural Studies:

    • Crystallography or cryo-EM to resolve the peripheral stalk’s architecture.

    • Interaction mapping with atpE or atpB.

  2. Biotechnology:

    • Production of ATP synthase components for biofuel or biohybrid systems.

Limitations

  • Sequence Gaps: Full-length P. tricornutum atpF sequence remains unreported .

  • Post-Translational Modifications: E. coli cannot perform eukaryotic N-glycosylation, which may affect activity in native systems .

Interaction Network and Partners

Interaction PartnerRoleEvidence
atpEStabilizes the ATP synthase complexSTRING interaction score: 0.996
atpBCatalytic subunit of ATP synthaseSTRING interaction score: 0.991
atpIProton channel subunit aSTRING interaction score: 0.996

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
atpF
Target Protein Sequence
MENFDQIFTLLAEHEGIGLNLNILETGLLNILTLVGILIYAGKDFLGSLLEERKTTIVKG VQDAEDRLNEAQKRLNEAQKQLNQANLVISEIRNETIATKKVLLESEVFGAKKDLKIRFE RALAMFKSKERQIFLEIKQQIISLVLKRTVIRAQQAFAPKERATTLINDTINKLEGDLL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembranous catalytic core; and the F(0) domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of AtpF in P. tricornutum ATP synthase?

AtpF functions as one of the peripheral stalk subunits (specifically subunit b) in the chloroplast ATP synthase complex. It provides structural support that connects the F₁ catalytic domain to the membrane-embedded F₀ domain, enabling the enzyme to harness the proton gradient for ATP synthesis. In P. tricornutum, knockout studies have demonstrated that AtpF is essential for proper ATP synthase assembly and function. Frame-shift mutations in the atpF gene completely prevent ATP synthase accumulation and function, highlighting its critical role in bioenergetics . The peripheral stalk formed by AtpF serves as a stator that prevents rotation of the catalytic subunits during ATP synthesis, allowing only the central rotor to turn during operation.

What experimental techniques are commonly used to validate recombinant AtpF expression?

Validation of recombinant AtpF expression typically involves a multi-method approach. Western blotting using antibodies specific to AtpF represents the standard approach for protein detection and quantification. Mass spectrometry provides precise identification and can detect post-translational modifications that may affect protein function . Functional complementation assays in AtpF-deficient mutants represent a powerful approach to validate biological activity, where restoration of ATP synthase function following introduction of the recombinant atpF gene confirms expression of functional protein. Researchers often employ fluorescent protein tagging (GFP/YFP) for subcellular localization studies to confirm proper targeting to chloroplasts. For structural validation, circular dichroism spectroscopy helps verify proper protein folding by analyzing secondary structure elements that are critical for AtpF functionality.

How do mutations in atpF affect ATP synthase assembly and photosynthetic capacity?

Mutations in the atpF gene have profound effects on ATP synthase assembly and subsequently on photosynthetic capacity. Frame-shift mutations completely prevent ATP synthase function and accumulation, as demonstrated in characterized atpF mutants . When ATP synthase assembly is compromised, proton accumulation in the thylakoid lumen cannot be properly dissipated, leading to lumen acidification that triggers non-photochemical quenching mechanisms. This protective response reduces photosynthetic efficiency under high light conditions, explaining why ATP synthase mutants often display high light sensitivity .

Studies crossing ATP synthase mutants with ftsh1-1 protease mutants have identified AtpH (another ATP synthase subunit) as an FTSH substrate and demonstrated that this protease significantly contributes to coordinated accumulation of ATP synthase subunits . The absence of functional AtpF appears to disrupt the stoichiometric assembly of the entire complex, suggesting the existence of quality control mechanisms that prevent accumulation of partially assembled complexes. Comparative analysis across P. tricornutum strains shows that mutations affecting energy metabolism pathways, including ATP synthesis, can substantially alter their adaptive capacity to different environmental conditions .

What methodological approaches are most effective for studying AtpF-protein interactions?

Several complementary approaches provide robust analysis of AtpF protein interactions. Co-immunoprecipitation coupled with mass spectrometry represents the gold standard for identifying protein-protein interactions, allowing researchers to pull down AtpF and identify associated proteins in the ATP synthase complex. Yeast two-hybrid assays can be used to screen for binary interactions between AtpF and other proteins, though this approach removes the native membrane environment context.

Bimolecular fluorescence complementation (BiFC) provides visualization of protein interactions in vivo, where split fluorescent protein fragments fused to AtpF and potential interacting partners reconstitute fluorescence when brought into proximity. For detailed structural analysis, cryo-electron microscopy has emerged as a powerful technique for visualizing the entire ATP synthase complex with near-atomic resolution, revealing precise interaction interfaces . Computational approaches including molecular dynamics simulations can model the dynamic interactions between AtpF and other peripheral stalk components based on structural data. These various methods provide complementary insights into how AtpF integrates into the peripheral stalk and interacts with other ATP synthase components.

How does AtpF contribute to the regulation of photosynthetic efficiency in response to environmental stress?

AtpF plays a critical role in maintaining photosynthetic efficiency under various environmental stresses by ensuring proper ATP synthase function. Under high light conditions, ATP synthase activity becomes particularly crucial for dissipating excess proton accumulation in the thylakoid lumen. Mutants lacking functional AtpF show high light sensitivity due to their inability to properly regulate lumen pH . Studies examining gene expression patterns across P. tricornutum morphotypes reveal that photosynthesis-related genes, including ATP synthase components, show differential expression under varying environmental conditions .

In acetate-supplemented conditions, P. tricornutum shows reduced photosynthetic efficiency and maximum electron transport rate, which has been attributed to over-reduction of electron transport components between photosystems . This finding suggests complex regulatory interactions between heterotrophic carbon utilization and photosynthetic apparatus function. The ATP synthase complex, through its role in maintaining proton motive force, plays a critical role in preventing photodamage by allowing continued electron flow through photosystems. AtpF's structural role in the peripheral stalk ensures that ATP synthase can respond appropriately to fluctuating energy demands under different environmental conditions.

What expression systems are most effective for producing recombinant AtpF?

The optimal expression system for recombinant AtpF production depends on downstream applications and required protein characteristics. For functional studies in P. tricornutum, homologous expression using the pPha-T1 plasmid system represents an effective approach, as demonstrated in successful transformations of other proteins like acetate transporters . This system maintains native post-translational modifications and proper targeting to chloroplasts. For structural studies requiring higher protein yields, heterologous expression in E. coli can be optimized using fusion tags (MBP, SUMO) to improve solubility of this membrane-associated protein.

When protein-protein interaction studies are the goal, expression in yeast systems provides eukaryotic processing machinery while maintaining reasonable yields. For all systems, codon optimization for the host organism is crucial, as P. tricornutum has distinct codon preferences compared to common expression hosts. Regardless of the expression system chosen, incorporating affinity tags (His, FLAG, Strep) facilitates purification while fusion with fluorescent proteins enables localization studies and visual confirmation of expression.

How can CRISPR-Cas9 be effectively utilized to study AtpF function?

CRISPR-Cas9 technology has revolutionized genetic manipulation in P. tricornutum and can be applied in several ways to study AtpF function. For complete loss-of-function studies, CRISPR-Cas9 can generate knockout AtpF mutants similar to those described in the literature that completely prevent ATP synthase accumulation . This approach requires careful guide RNA design targeting the atpF coding sequence while avoiding off-target effects.

For studying specific functional domains, CRISPR-Cas9 can be used for precise editing to introduce point mutations or small deletions in regions of interest. When combined with homology-directed repair, site-specific tags can be integrated for tracking AtpF localization and interactions without disrupting function. To study regulatory elements, CRISPR interference (CRISPRi) using catalytically inactive Cas9 can temporarily reduce AtpF expression without permanent genetic changes. For temporal control of gene function, inducible CRISPR systems allow for synchronized atpF disruption across a cell population. When studying AtpF variants, CRISPR can facilitate the replacement of the native gene with recombinant versions carrying specific modifications of interest.

What purification strategies yield the highest quality recombinant AtpF protein?

Purifying high-quality recombinant AtpF requires specialized strategies given its membrane association within the ATP synthase complex. The most effective approach begins with optimized cell lysis using mild detergents (DDM, LMNG) that solubilize membrane proteins without denaturing them. Affinity chromatography using N- or C-terminal tags (His, Strep) provides the initial purification step, with careful buffer optimization to maintain protein stability.

For higher purity, ion exchange chromatography can be employed as a secondary step, taking advantage of AtpF's specific charge properties. Size exclusion chromatography is crucial for separating properly folded protein from aggregates and for assessing the oligomeric state of the purified protein. For structural studies requiring removal of detergent, the protein can be reconstituted into nanodiscs or liposomes to maintain a membrane-like environment while improving stability. Quality assessment through circular dichroism, thermal shift assays, and activity measurements helps confirm that the purified protein maintains its native conformation and functionality.

How can recombinant AtpF be utilized for elucidating the evolutionary history of diatom ATP synthases?

Recombinant AtpF provides a valuable tool for comparative evolutionary studies of ATP synthase components across diatom species. By expressing recombinant AtpF variants from different diatom species in a common background, researchers can directly assess functional conservation and divergence. Structural studies of recombinant AtpF from diverse diatoms can reveal evolutionary adaptations in protein-protein interaction interfaces that may correlate with specific environmental adaptations.

The silicification process in diatoms like P. tricornutum requires substantial energy input, suggesting potential co-evolution between ATP synthase efficiency and silica morphogenesis mechanisms . The process of silica formation begins with a 'π-like' structure that guides sternum organization, with ATP likely playing a crucial role in this energy-intensive process . Comparative analysis of AtpF sequences across diatom lineages can identify conserved regions essential for function versus variable regions that may reflect species-specific adaptations. This research direction can provide insights into how energy production systems co-evolved with unique diatom features like silicified cell walls.

What is the potential interplay between AtpF function and lipid metabolism in P. tricornutum?

A complex relationship exists between ATP synthase function and lipid metabolism in P. tricornutum, with AtpF playing a central role in this interaction. ATP synthase activity directly impacts the energetics available for fatty acid synthesis, while membrane lipid composition can affect ATP synthase function and assembly. Studies investigating acetate utilization in P. tricornutum have shown that alterations in carbon metabolism affect both crude lipid content and fatty acid composition . Specifically, increases in C16:1n-7 at the expense of EPA and decreases in unsaturation index have been observed in genetically modified strains .

Genetic manipulation of ATP synthase components, including AtpF, likely affects lipid metabolism through altered energetic balance. P. tricornutum strain Pt3 shows upregulation of fatty acid biosynthesis pathways compared to other strains, suggesting strain-specific relationships between energy production and lipid metabolism . This relationship is particularly relevant for biotechnological applications focused on lipid production, as proper ATP synthase function is critical for efficient triacylglycerol accumulation. Future research should explore how modifications to AtpF affect both ATP synthesis capacity and downstream lipid metabolism pathways.

Table 1: Comparative Analysis of ATP Synthase Subunit Expression in P. tricornutum Strains

P. tricornutum StrainATP Synthase Expression PatternAssociated Metabolic PathwaysMorphotype
Pt 3 FuNo significant enrichment foundN/AFusiform
Pt 3 OvNo significant enrichment foundN/AOval
Pt 3 TrNo significant enrichment foundN/ATriradiate
Pt 3Higher expression of energy metabolism genesFatty acid biosynthesis, Porphyrin and chlorophyll metabolismMixed
Pt 4Lower expression of energy metabolism genesTCA cycle, Pyruvate metabolism, GlycolysisMixed
Pt 8Higher expression of photosynthesis genesPhotosynthesis, Fatty acid biosynthesisMixed

Data derived from meta-analysis of RNA-Seq datasets from different P. tricornutum strains

Table 2: Effect of ATP Synthase Mutations on Cellular Function in Photosynthetic Organisms

Mutated GeneAffected SubunitPhenotypic EffectImpact on ATP Synthase AssemblyReference
atpFPeripheral stalk subunit bPrevents ATP synthase function and accumulationComplete inhibition
ATPGPeripheral stalk subunit b'Prevents ATP synthase function and accumulation (knockout); Reduced function (knockdown)Complete inhibition (knockout); Reduced assembly (knockdown)
atpEε subunitFully prevents ATP synthase biogenesisComplete inhibition
ftsh1-1 + ATP synthase mutationsAffects subunit AtpH degradationReveals FTSH as contributor to ATP synthase subunit accumulationAffects coordinated accumulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.