Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic (atpG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic (atpG)

Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic (atpG) refers to a specific subunit of the ATP synthase enzyme found in the chloroplasts of the diatom Phaeodactylum tricornutum . ATP synthase is an essential enzyme complex that produces ATP (adenosine triphosphate), the primary energy currency of cells, through chemiosmosis, where ions move down their electrochemical gradient . In chloroplasts, this process is driven by the proton gradient generated during photosynthesis .

Role in Chloroplast ATP Synthase Biogenesis

The biogenesis of chloroplast ATP synthase requires the coordinated assembly of subunits from both plastid and nuclear origins . The atpE mRNA, which encodes another subunit of the ATP synthase, is stabilized by the nuclear factor MDE1 . MDE1 is an octotricopeptide repeat (OPR) protein that targets the 5'UTR of the atpE gene, exemplifying a nucleus/chloroplast interplay that evolved relatively recently .

Functional Significance

The ATP synthase complex, including the b' subunit, is crucial for photosynthesis . It uses the proton gradient generated across the thylakoid membrane to synthesize ATP, which is then used to power various cellular processes . Mutants with impaired ATP synthase function exhibit high light sensitivity, indicating the importance of this enzyme under light stress conditions .

Metabolic Engineering and Applications

Phaeodactylum tricornutum has the ability to produce plant triterpenoids, making it a candidate for the production of valuable metabolites . Introducing multiple plant enzymes can lead to the production of triterpenes such as betulin and lupeol .

Vacuolar H+-ATPase and Lipid Production

In Phaeodactylum tricornutum, the vacuolar H+-ATPase plays a pivotal role in regulating lipid production . RNA-Seq analysis has shown that inhibiting V-ATPase with bafilomycin A1 (BFA1) affects the expression of genes involved in various metabolic pathways, including calcium signaling, sulfur metabolism, and lipid metabolism .

Meta-Analysis of RNA-Seq Datasets

Meta-analysis of RNA-Seq datasets from different strains of Phaeodactylum tricornutum indicates variations in gene expression related to N-glycosylation, protein export, protein quality control, and proteasome activity . The Pt4 strain appears to be optimal for the production of recombinant proteins .

Table 1: Pathways Significantly Enriched with Differentially Expressed Genes

Pathways significantly enriched with more expressed than the reference strain genesPathways significantly enriched with less expressed than the reference strain genes
Pt 3 FuNo significant enrichment found
Pt 3 OvNo significant enrichment found
Pt 3 TrNo significant enrichment found
Pt 3Valine, leucine and isoleucine degradation
Pt 4Citrate cycle (TCA cycle)
Pt 8Ribosome biogenesis in eukaryotes

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will fulfill requests as possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF2; atpG; ATP synthase subunit b', chloroplastic; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
atpG
Target Protein Sequence
MINISMLISNSEVSGPGGLFDFNATLPLVAIQFILLMVLLNILLYNPLLTIIEERKEYIL TNLGKASELLSEANKLTQQYEQELDNVRKEAQLEITNSQKIHKEILEVELNISQKYIDNL LDTIQKDLLAKKNIALNSLDEIVQSLCVDIEARLSI
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extra-membranous) and the F(0) membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b'-subunit, a divergent and duplicated form of the b-subunit found in plants and photosynthetic bacteria, is a component of the F(0) channel and forms part of the peripheral stalk, connecting F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural role of ATP synthase subunit b' in Phaeodactylum tricornutum chloroplasts?

ATP synthase subunit b' in P. tricornutum, like in other photosynthetic organisms, forms a critical component of the peripheral stalk that connects the membrane-embedded FO motor to the catalytic F1 head. The protein displays characteristic extended helical domains that span the distance between the membrane and the α3β3 catalytic core, allowing it to function as a structural stator. Despite low sequence conservation with other organisms, the P. tricornutum subunit b' maintains high structural similarity (>97% probability in structural prediction analyses) with homologous proteins .

The chloroplastic ATP synthase in P. tricornutum is located in the thylakoid membrane, specifically in stroma lamellae and flat grana end membranes, similar to other algae. Unlike mitochondrial ATP synthases that form dimers, the chloroplastic ATP synthase exists predominantly as a monomer and does not induce membrane bending . This spatial organization is important for efficient energy coupling during photophosphorylation.

How can researchers successfully express and purify recombinant P. tricornutum ATP synthase subunit b'?

The expression and purification of recombinant P. tricornutum ATP synthase subunit b' requires specialized approaches due to the unique genetic characteristics of diatoms. Successful expression typically involves:

  • Vector selection: Utilizing diatom-specific expression vectors containing appropriate promoters (such as fucoxanthin chlorophyll a/c binding protein promoters) that ensure high expression levels in photosynthetic organisms.

  • Codon optimization: Adapting the coding sequence to the codon usage bias of P. tricornutum, which differs significantly from model organisms like E. coli.

  • Affinity tag placement: Careful placement of affinity tags to avoid disrupting the extended helical domain structure that is critical for function. C-terminal tags are often preferred as they minimally interfere with membrane insertion.

  • Extraction protocol: Using specialized detergents (such as n-dodecyl β-D-maltoside or digitonin) for membrane protein extraction followed by affinity chromatography, ion exchange, and size exclusion chromatography for purification.

P. tricornutum is amenable to genetic transformation using methods similar to those employed for expressing recombinant proteins in other studies with this organism , though the hydrophobic nature of membrane proteins like ATP synthase subunits presents additional challenges.

What techniques are most effective for verifying the integration of recombinant ATP synthase subunit b' into functional ATP synthase complexes?

Verification of proper integration requires a multi-method approach:

  • Blue Native Polyacrylamide Gel Electrophoresis (BNP): This technique can identify intact monomer and dimer forms of the ATP synthase complex. Proper integration of recombinant subunit b' would be confirmed by detecting the protein in the assembled complex (~600 kDa for monomers, >1 MDa for dimers) .

  • Immunoprecipitation (IP): Using antibodies against other known ATP synthase subunits to co-precipitate the recombinant subunit b', confirming its physical association with the complex.

  • LC-MS/MS analysis: Mass spectrometry can confirm the presence of recombinant subunit b' in purified ATP synthase complexes, similar to the approach used to identify novel ATP synthase components in Toxoplasma gondii .

  • Enzymatic activity assays: Measuring ATP synthesis/hydrolysis rates in preparations containing the recombinant protein compared to wild-type controls.

  • Fluorescence resonance energy transfer (FRET): If the recombinant protein is tagged with a fluorescent marker, FRET can be used to demonstrate proximity to other labeled subunits in the complex.

How does the amino acid sequence of P. tricornutum ATP synthase subunit b' differ from homologs in other photosynthetic organisms, and what are the functional implications?

The ATP synthase subunit b' in P. tricornutum exhibits remarkable sequence divergence compared to homologs in other photosynthetic organisms, while maintaining structural conservation critical for function. This represents a classic example of sequence-structure relationship where tertiary structure is preserved despite primary sequence variation.

Analysis reveals several key differences:

  • Coiled-coil domains: P. tricornutum subunit b' contains modified coiled-coil motifs that interact with other stalk components. These domains show lower sequence identity but preserved helical propensity compared to plant and green algal homologs.

  • Membrane-anchoring region: The transmembrane domain exhibits diatom-specific adaptations, possibly reflecting the unique lipid composition of diatom thylakoid membranes.

  • Interaction interfaces: Residues that mediate interaction with the F1 sector show specific substitutions that maintain physicochemical properties rather than exact sequence identity.

These sequence adaptations likely evolved to optimize ATP synthase function within the unique photosynthetic apparatus of diatoms, which differs significantly from that of green algae and land plants. Diatoms possess distinct light-harvesting complexes and thylakoid membrane organization, which may necessitate specialized adaptations in ATP synthase architecture .

What experimental approaches can elucidate the role of post-translational modifications of ATP synthase subunit b' in regulating P. tricornutum energy metabolism?

Post-translational modifications (PTMs) of ATP synthase subunits are emerging as important regulatory mechanisms in photosynthetic organisms. To investigate PTMs of P. tricornutum ATP synthase subunit b', researchers should employ:

  • Phosphoproteomic analysis: Using titanium dioxide enrichment followed by LC-MS/MS to identify phosphorylation sites that may regulate stator flexibility or interactions with other subunits.

  • Redox proteomics: Employing differential alkylation techniques to identify cysteine residues subject to oxidation/reduction, similar to the redox switch identified in the γ subunit that regulates plant ATP synthase activity in response to light/dark transitions .

  • Site-directed mutagenesis: Creating point mutations at putative modification sites followed by phenotypic analysis to determine functional significance.

  • Environmental stress experiments: Exposing cultures to various stressors (light intensity, temperature, nutrient limitation) followed by PTM profiling to identify condition-specific modifications.

  • In vitro reconstitution: Comparing the activity of recombinant proteins with and without specific modifications to directly assess their impact on ATP synthase function.

These approaches should be conducted under physiologically relevant conditions, as P. tricornutum, like other diatoms, has evolved unique regulatory mechanisms to thrive in fluctuating marine environments.

What are the most effective strategies for performing site-directed mutagenesis to investigate critical residues in P. tricornutum ATP synthase subunit b'?

Site-directed mutagenesis of P. tricornutum ATP synthase subunit b' requires specialized approaches due to the unique genetic characteristics of diatoms:

  • CRISPR-Cas9 genome editing: This is currently the most efficient approach for introducing precise mutations in P. tricornutum. Key considerations include:

    • Designing sgRNAs with diatom-specific parameters for optimal targeting

    • Using homology-directed repair templates with diatom-optimized selection markers

    • Implementing antibiotic selection strategies appropriate for P. tricornutum

  • Complementation strategy: For essential residues where direct genome editing might be lethal:

    • Expressing the mutant version while suppressing the endogenous gene through RNAi

    • Using inducible promoters to control expression timing

  • Target selection: Based on structural predictions and alignments with better-characterized homologs, priority targets should include:

    • Residues in the membrane-spanning region that may interact with the c-ring or subunit a

    • Coiled-coil interface residues that mediate dimerization or interaction with other stalk components

    • Residues at the interface with F1 that transfer conformational changes

  • Validation approaches: Confirmation of successful mutagenesis should include:

    • Genomic PCR and sequencing

    • Western blotting to confirm expression

    • BNP electrophoresis to assess complex assembly

    • Functional assays measuring ATP synthesis under various conditions

How can researchers accurately determine the stoichiometry and spatial arrangement of subunit b' in the P. tricornutum ATP synthase complex?

Determining the precise stoichiometry and spatial arrangement of subunit b' requires complementary structural biology techniques:

  • Cryo-electron microscopy (cryo-EM): Currently the most powerful approach for determining ATP synthase structure, as demonstrated for chloroplast ATP synthase from other organisms . For P. tricornutum specifically:

    • Sample preparation should employ gentle detergent solubilization to maintain native interactions

    • Multiple conformational states should be captured to understand dynamic arrangements

    • Image processing should account for the inherent flexibility of the peripheral stalk

  • Cross-linking mass spectrometry (XL-MS): This technique identifies spatial proximity between subunits through:

    • Chemical cross-linking of adjacent lysine residues or other amino acids

    • Enzymatic digestion followed by LC-MS/MS analysis

    • Computational modeling to generate distance constraints

  • Quantitative proteomics: To determine stoichiometry:

    • Absolute quantification using synthetic peptide standards

    • Comparison of subunit b' abundance relative to known components with established stoichiometry

  • Genetic labeling approaches: For in vivo visualization:

    • Split-GFP complementation to confirm interaction partners

    • Multi-color labeling to determine relative positions of subunits

The following table summarizes the predicted protein-protein interaction partners of ATP synthase subunit b' in P. tricornutum based on structural homology with other ATP synthases:

Interacting SubunitInteraction Region on Subunit b'Functional SignificanceDetection Method
Subunit aN-terminal membrane domainAnchoring to F₀ sectorCross-linking MS
Subunit δC-terminal domainConnection to F₁ sectorCo-immunoprecipitation
Second subunit b'Central coiled-coil domainDimerization for stator rigidityFRET analysis
Subunit αC-terminal domainStabilization of catalytic coreSurface plasmon resonance
Subunit dCentral regionPeripheral stalk assemblyYeast two-hybrid

What are the major challenges in crystallizing recombinant P. tricornutum ATP synthase subunit b' for structural studies?

Crystallization of membrane proteins like ATP synthase subunit b' presents several specific challenges:

  • Protein stability: The extended helical structure of subunit b' is inherently flexible, which hinders crystal formation. Stabilization strategies include:

    • Co-crystallization with binding partners

    • Introduction of disulfide bonds to rigidify flexible regions

    • Use of antibody fragments to stabilize specific conformations

  • Detergent selection: The hydrophobic transmembrane domain requires careful detergent screening, as different detergents can significantly impact crystallization success. Key considerations include:

    • Detergent micelle size should complement the hydrophobic surface area

    • Mixed detergent systems may better mimic the native membrane environment

    • Lipid-detergent mixtures can help maintain native-like interactions

  • Construct design: The peripheral stalk components like subunit b' often contain disordered regions that impede crystallization. Approaches to address this include:

    • Truncation series to identify minimal stable domains

    • Surface entropy reduction through mutation of flexible charged residues

    • Fusion with crystallization chaperones like T4 lysozyme

  • Crystallization conditions: The amphipathic nature of membrane proteins requires specialized crystallization approaches:

    • Bicelle or lipidic cubic phase methods may be more successful than traditional vapor diffusion

    • Dehydration protocols to improve crystal packing

    • Microseeding to promote nucleation

These challenges explain why high-resolution structures of complete ATP synthases have primarily been determined by cryo-EM rather than crystallography in recent years .

How can transcriptomic and proteomic approaches be integrated to study ATP synthase subunit b' expression regulation in P. tricornutum?

An integrated omics approach provides powerful insights into the regulation of ATP synthase components:

This integrated approach can reveal how P. tricornutum coordinates the expression of nuclear-encoded ATP synthase components with the needs of chloroplast energy production.

How can synthetic biology approaches be applied to engineer modified versions of P. tricornutum ATP synthase subunit b' for enhanced photosynthetic efficiency?

Synthetic biology offers promising avenues for optimizing ATP synthase function in P. tricornutum:

These approaches could potentially enhance bioenergy applications of P. tricornutum, which is already being explored as a platform for sustainable production of various compounds .

What computational approaches are most effective for predicting the structure and functional dynamics of P. tricornutum ATP synthase subunit b'?

Modern computational biology offers several approaches for studying proteins with low sequence conservation but preserved structural features, like ATP synthase subunit b':

  • AlphaFold2 and other AI-based structure prediction:

    • These methods have revolutionized protein structure prediction and can be effective even for proteins with few homologs

    • For membrane proteins like subunit b', special consideration of the lipid bilayer environment is necessary

    • Confidence metrics should be carefully evaluated, particularly for regions predicted to have high flexibility

  • Molecular dynamics simulations:

    • All-atom simulations can reveal dynamics of the peripheral stalk under different conditions

    • Coarse-grained simulations allow exploration of longer timescales relevant to ATP synthase function

    • Integration of experimental constraints (from cross-linking or FRET) improves simulation accuracy

  • Elastic network models:

    • These simplified models are particularly useful for studying large-scale conformational changes

    • Can reveal how flexibility of the peripheral stalk contributes to energy transfer during catalysis

    • Allow rapid exploration of how mutations might affect mechanical properties

  • Protein-protein docking:

    • Predicting interfaces between subunit b' and other ATP synthase components

    • Evaluation of binding energies to identify critical interaction residues

    • Ensemble docking to account for conformational flexibility

  • Evolutionary coupling analysis:

    • Despite sequence divergence, co-evolving residue pairs can provide valuable structural constraints

    • Integration with other prediction methods enhances model accuracy

    • Can identify functionally important regions even in the absence of experimental structures

These computational approaches can guide experimental design by identifying promising targets for mutagenesis or providing structural context for interpreting experimental results.

How does the sequence and structure of ATP synthase subunit b' differ between diatoms and other photosynthetic organisms?

ATP synthase subunit b' shows remarkable evolutionary divergence across photosynthetic lineages, reflecting the complex evolutionary history of photosynthetic organisms:

  • Sequence divergence patterns:

    • Diatom ATP synthase subunits, including b', show extreme sequence diversification compared to green algae and land plants

    • This divergence is consistent with the evolutionary distance between heterokonts (including diatoms) and the green lineage

    • Despite low sequence identity, key structural features are preserved

  • Domain architecture comparison:

    • All versions maintain the fundamental organization of a membrane-anchoring domain and an extended stalk region

    • The relative length of these domains varies, with diatoms showing distinct proportions

    • The number and position of coiled-coil regions show lineage-specific patterns

  • Taxonomic distribution of features:

    • Some features of diatom ATP synthase subunit b' are shared with other stramenopiles

    • Other features appear to be diatom-specific adaptations

    • The presence in P. tricornutum of certain motifs absent in ciliates indicates a major divergence within alveolates

  • Functional implications:

    • These differences likely reflect adaptations to different photosynthetic apparatus organizations

    • The unique thylakoid membrane architecture of diatoms may impose specific constraints on ATP synthase structure

    • Differences in regulatory mechanisms between lineages may be reflected in subunit structure

This evolutionary perspective provides important context for understanding the structural and functional adaptations of ATP synthase across diverse photosynthetic organisms.

What can be learned from comparative analysis of ATP synthase actin-binding protein homologs in P. tricornutum?

P. tricornutum contains several actin and actin-binding protein homologs that may interact with or influence ATP synthase function, offering insights into the evolutionary relationship between cytoskeletal and bioenergetic systems:

Protein FamilyP. tricornutum HomologAccession NumberPotential Role in ATP Synthase Function
CofilinPhatr3_EG00210B7FTG3May influence membrane dynamics affecting ATP synthase distribution
Capping ProteinPhatr3_J35252B7FXZ8Could regulate actin filaments that interact with chloroplast membranes
ForminPhatr3_J54510B7FZU7Actin nucleation potentially affecting organelle positioning
DynaminPhatr3_J54751B7G3L7Membrane remodeling potentially affecting ATP synthase distribution
TropomodulinPhatr3_J47725B7G4N9Regulation of actin filament length and stability

The presence of these actin-binding protein homologs suggests several intriguing possibilities:

  • Cytoskeletal-organelle interactions: The actin cytoskeleton may play a role in positioning chloroplasts and potentially influencing the distribution or organization of ATP synthase complexes within thylakoid membranes.

  • Evolutionary repurposing: Some actin-binding proteins may have been repurposed during evolution to interact with ATP synthase components, representing a form of molecular exaptation.

  • Regulatory mechanisms: Cytoskeletal interactions could represent an understudied regulatory mechanism for ATP synthase, potentially responding to cellular mechanical forces or contributing to the spatial regulation of energy production.

  • Methodological implications: The presence of these interactions suggests that when studying ATP synthase in isolation, researchers should consider potential impacts of disrupting cytoskeletal associations.

Comparative analysis across diatom species and with other algal groups could reveal whether these potential interactions represent conserved mechanisms or lineage-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.