Recombinant Phaeodactylum tricornutum Cytochrome b559 subunit alpha (psbE)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant psbE is produced via bacterial expression systems, typically in E. coli, with optimized protocols for yield and stability:

ParameterSpecification
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
StabilityLyophilized powder; store at -20°C/-80°C (avoid repeated freeze-thaw cycles)
ReconstitutionDeionized water (0.1–1.0 mg/mL), with 5–50% glycerol for long-term storage

Protein reconstitution guidelines emphasize careful handling to prevent aggregation .

Role in PSII Assembly and Photoprotection

  • Structural Importance: The alpha subunit’s Arg residues (e.g., Arg7, Arg8, Arg18) interact with heme propionates, influencing redox properties and PSII stability .

  • Functional Redundancy: Mutants lacking heme coordination retained PSII activity, suggesting compensatory mechanisms in T. elongatus .

Expression in Diatoms

While recombinant psbE is produced in E. coli, Phaeodactylum tricornutum itself is a model for algal biotechnology:

  • Protein Expression: This diatom has been engineered to produce complex proteins (e.g., IgG antibodies, HBsAg) with proper post-translational modifications .

  • Potential for psbE: Though not directly reported, its genetic toolkit could enable native psbE overexpression for studying photosynthetic pathways .

Comparative Biochemical Studies

Research on Cytochrome b559 in other organisms (e.g., Synechocystis, T. elongatus) highlights its dual roles:

OrganismKey Findings
SynechocystisHeme coordination is critical for PSII stability .
T. elongatusPSII recovery from photoinhibition is impaired in heme-deficient mutants .
Phaeodactylum tricornutumGenomic resources enable cloning of lipid metabolism enzymes (e.g., Δ5/Δ6 desaturases) .

Biotechnological Relevance

The recombinant psbE protein serves as a tool for:

  1. Structural Biology: Studying PSII’s reaction center dynamics and interactions with light-harvesting complexes (e.g., FCPs) .

  2. Redox Biochemistry: Investigating Cytochrome b559’s role in superoxide dismutase activity and quinone binding .

  3. Algal Engineering: Leveraging P. tricornutum’s capacity for heterologous protein production to explore synthetic biology applications .

Challenges and Future Directions

  • Heterologous Expression: Optimizing psbE yield in E. coli while maintaining functional integrity.

  • Functional Studies: Elucidating psbE’s role in diatom-specific photosynthetic adaptations.

  • Industrial Applications: Exploring its use in biofuels or photoprotection systems for algal biofactories .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-84
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
psbE
Target Protein Sequence
MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTQD RQQIPLVNDRFSAKQELEDLTKGL
Uniprot No.

Target Background

Function
This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation.
Protein Families
PsbE/PsbF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.