Recombinant Phaeodactylum tricornutum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Phaeodactylum tricornutum Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Phaeodactylum tricornutum Cytochrome b6-f complex subunit 4 (petD) is a protein that is produced using recombinant DNA technology, where the gene encoding the full-length Cytochrome b6-f complex subunit 4 (petD) from the diatom Phaeodactylum tricornutum is expressed in a host organism, such as E. coli . The resulting protein, often fused to an N-terminal His tag for purification, is isolated and purified for various research and industrial applications .

Applications in Research

  • Photosynthesis Research: Recombinant petD is employed in photosynthesis research to investigate the structure, function, and regulation of the cytochrome b6-f complex . It helps elucidate the mechanisms of electron transport, proton gradient formation, and energy production in photosynthetic organisms .

  • Photoacclimation Studies: Phaeodactylum tricornutum adapts to varying light conditions through photoacclimation, a process involving changes in gene expression and protein synthesis . Recombinant petD assists in studying how diatoms regulate their photosynthetic machinery in response to different light intensities .

  • Biotechnological Applications: Given the importance of diatoms in carbon fixation and lipid production, recombinant petD can be used to enhance photosynthetic efficiency and lipid accumulation in P. tricornutum . This has implications for biofuel production and other biotechnological applications .

Data Table: Transcript Abundances in Phaeodactylum tricornutum Under Different Light Conditions

GeneFold Change (Low Light vs. High Light)
psbU2.0-2.5
psbQ/oee32.0-2.5
psbO2.0-2.5
hcf1362.0
psb272.0
c5532.2

This table illustrates the upregulation of several photosynthetic genes, including those associated with PSII, under low light conditions, highlighting the adaptive response of P. tricornutum to optimize light harvesting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
petD
Target Protein Sequence
MSVIKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPLTMLGTLTCIVGLSVLAPT QLGEPADPFNTPLEILPEWYFFPTFNLLRVLPNKLLGVLAMAAVPLGLITVPFIENVNKF QNPFRRPLASLTFIFGFFTAVWLGIGACVPIDKAISLGFW
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex in Phaeodactylum tricornutum and what role does the petD subunit play?

The Cytochrome b6-f complex is a crucial component of the photosynthetic electron transport chain in P. tricornutum. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), enables cyclic electron flow around PSI, and contributes to state transitions . The petD gene encodes subunit 4 of this complex, a 17 kDa polypeptide that plays an essential structural and functional role. The intact complex is vital for maintaining efficient photosynthetic electron flow, which directly impacts the diatom's ability to generate energy through photosynthesis.

Experimental evidence shows that disruptions to components of the electron transport chain, including the Cytochrome b6-f complex, can significantly alter photosynthetic efficiency, as measured by parameters such as Fv/Fm (maximum quantum yield of PSII) and relative electron transport rates (rETR) .

What methods are available for detecting and quantifying petD protein in experimental samples?

Several complementary techniques can be employed for detecting and quantifying petD protein:

  • Western Blot Analysis:

    • Using antibodies specific to petD or to fusion tags (His, FLAG, GFP)

    • Allows detection of protein expression, secretion, and approximate molecular weight

    • Can reveal post-translational modifications if protein migrates at unexpected molecular weights

  • Mass Spectrometry-Based Proteomics:

    • iTRAQ (isobaric tags for relative and absolute quantification) allows simultaneous identification and quantification across multiple samples

    • LC-MS/MS analysis can identify petD-derived peptides with high sensitivity

    • Data independent acquisition (DIA) within mass range 350–1500 m/z provides comprehensive coverage

  • Fluorescence Techniques (if using fluorescent protein fusions):

    • Direct visualization of protein localization within cells

    • Fluorescence intensity measurements for semi-quantitative analysis

    • FRET (Förster Resonance Energy Transfer) for interaction studies

  • Enzymatic Activity Assays:

    • Measurement of electron transport rates as a proxy for functional complex activity

    • Oxygen evolution measurements to assess photosynthetic capacity

    • PAM (Pulse Amplitude Modulation) fluorometry to measure photosynthetic parameters

What CRISPR-Cas9 strategies are most effective for generating petD knockout mutants in Phaeodactylum tricornutum?

Based on successful CRISPR-Cas9 approaches used for other proteins in P. tricornutum, researchers can implement the following strategy for petD modification:

  • Guide RNA Design:

    • Target regions encoding functional domains in the petD gene

    • Multiple gRNAs may be designed to increase knockout efficiency

    • Tools like CRISPOR or CHOPCHOP can assist in designing efficient gRNAs with minimal off-target effects

  • Delivery Method:

    • Bacterial transkingdom conjugation has been successfully used for extrachromosomal expression in P. tricornutum

    • Biolistic transformation (gene gun) can also be employed

  • Selection Strategy:

    • Use of selectable markers like nourseothricin resistance gene (NAT) under appropriate promoters (e.g., FcpC)

    • Screening of transformants via PCR, followed by sequencing to verify modifications

  • Functional Validation:

    • Western blot analysis to confirm absence of the petD protein

    • Phenotypic characterization including growth rates, photosynthetic parameters, and electron transport measurements

    • Complementation experiments by reintroducing wild-type or modified petD to verify phenotype restoration

In a similar study with KEA3 knockout mutants, researchers selected clones containing truncated proteins without the catalytic transmembrane domain and verified the absence of the protein using Western blot . This approach can be adapted for petD studies.

How can proteomics approaches be optimized to study petD expression under multiple environmental stressors?

To comprehensively analyze petD expression under multiple stressors, researchers can implement an integrated proteomics workflow:

  • Experimental Design:

    • Factorial design exploring combinations of relevant stressors (temperature, light intensity, nutrient availability, CO2 concentration)

    • Time-course sampling to capture dynamic responses

    • Include appropriate controls for each factor and their combinations

  • Sample Preparation:

    • Optimize protein extraction protocols specific for membrane proteins like petD

    • Consider subcellular fractionation to enrich for chloroplast/thylakoid membranes

    • Use detergents appropriate for membrane protein solubilization

  • Quantitative Proteomics Methodology:

    • iTRAQ or TMT (Tandem Mass Tags) labeling for multiplexed quantitation

    • Label-free quantification as an alternative approach

    • SWATH-MS (Sequential Window Acquisition of all Theoretical Mass Spectra) for comprehensive peptide coverage

  • Data Analysis:

    • Multivariate statistical analysis (PCA, PLS-DA) to discriminate between sample groups

    • Pathway analysis to contextualize petD regulation within broader cellular responses

    • Identification of protein biomarkers using PLS-DA VIP (Variable Importance in Projection) scores

This approach successfully identified 15 protein biomarkers for discriminating between samples under various stress conditions in diatoms, with five proteins (rbcL, PRK, atpB, DNA-binding, and signal transduction) identified as key biomarkers induced by temperature and silicate stress .

What role does the petD protein play in Phaeodactylum tricornutum's adaptation to fluctuating light conditions?

The Cytochrome b6-f complex, containing petD, plays a critical role in diatom adaptation to fluctuating light conditions:

  • Dark-to-Light Transitions:

    • When returned to light after prolonged darkness, P. tricornutum shows distinct expression profiles for nuclear genes involved in photosynthesis

    • Rapid rise in photosynthetic parameters (α and rETRmax) occurs within 0.5 h of re-exposure to light despite minimal de novo synthesis of photosynthetic compounds

    • Enhanced resonance energy transfer from fucoxanthin chlorophyll a/c-binding protein complexes to PSII reaction centers within the first 0.5 h

  • High Light Responses:

    • Under high light stress, decreases occur in major light harvesting pigments (chlorophyll a, β-carotene, fucoxanthin) and chloroplastidic membrane lipids

    • These physiochemical phenotypes are generally recovered when stress is removed, indicating rapid and reversible adaptation mechanisms

    • Transcriptional control of photosynthesis and carbon metabolism is central to this response

  • Non-Photochemical Quenching (NPQ) Regulation:

    • The cytochrome b6-f complex influences proton gradient formation across the thylakoid membrane

    • This gradient is critical for NPQ activation, a key photoprotective mechanism

    • Studies with other photosynthetic complex mutants (e.g., KEA3) show altered NPQ responses, suggesting similar potential roles for petD modifications

Understanding petD's specific contribution to these adaptive responses requires targeted studies comparing wild-type cells with petD-modified strains under fluctuating light conditions.

How can multi-omics approaches be integrated to understand petD's role in carbon fixation under varying environmental conditions?

A comprehensive multi-omics strategy can reveal petD's role in carbon fixation across environmental conditions:

  • Transcriptomics:

    • RNA-seq to quantify petD transcript levels alongside carbon metabolism genes

    • Analysis of correlation between petD expression and carbon fixation pathway genes

    • Identification of co-regulated gene clusters under different conditions

  • Proteomics:

    • Quantification of petD protein abundance and post-translational modifications

    • Analysis of stoichiometric relationships with other photosynthetic complexes

    • Protein-protein interaction studies to identify functional assemblies

  • Metabolomics:

    • Measurement of carbon fixation intermediates and end products

    • Isotope labeling studies (13C) to track carbon flux

    • Analysis of metabolic shifts in response to changing conditions

  • Physiological Measurements:

    • Direct measurement of carbon fixation rates

    • Chlorophyll fluorescence parameters (Fv/Fm, NPQ, electron transport rates)

    • Oxygen evolution and consumption rates

Research on carbon concentration mechanisms in P. tricornutum has shown that phosphoenolpyruvate carboxylase (PEPC) contributes to carbon fixation at low inorganic carbon concentrations . Similar approaches could reveal how petD expression and function interfaces with these carbon concentration mechanisms.

Data integration can be achieved using multivariate statistical approaches like PCA and PLS-DA to identify patterns and relationships across these multi-omics datasets .

What approaches can be used to study the interaction between petD and other subunits of the Cytochrome b6-f complex?

Several complementary approaches can reveal petD's interactions within the Cytochrome b6-f complex:

  • Structural Biology Methods:

    • Cryo-electron microscopy of purified complexes

    • X-ray crystallography (challenging but potentially high-reward)

    • Computational prediction and docking studies using tools like ColabFold and MOE software

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Blue native gel electrophoresis to preserve native complex interactions

    • Crosslinking mass spectrometry to identify interaction interfaces

  • In vivo Interaction Visualization:

    • FRET (Förster Resonance Energy Transfer) between tagged subunits

    • Split GFP or BiFC (Bimolecular Fluorescence Complementation)

    • Proximity labeling approaches (BioID, APEX)

  • Genetic Approaches:

    • Suppressor screens to identify compensatory mutations

    • Synthetic genetic array analysis to map genetic interactions

    • Site-directed mutagenesis to disrupt specific interaction surfaces

Evidence from protein structure prediction and docking studies for other proteins in P. tricornutum demonstrates the utility of computational approaches for understanding protein interactions prior to experimental validation .

How can petD from Phaeodactylum tricornutum be engineered for enhanced photosynthetic efficiency?

Engineering petD for improved function requires a systematic approach:

  • Rational Design Strategies:

    • Structure-guided mutagenesis targeting residues involved in electron transfer

    • Modifications to optimize protein stability under stress conditions

    • Engineering interfaces with other complex components to enhance assembly or function

  • Directed Evolution Approaches:

    • Development of high-throughput screening methods for photosynthetic efficiency

    • Random mutagenesis coupled with selection for improved growth under limiting conditions

    • Shuffling of petD sequences from different species to identify beneficial combinations

  • Expression Optimization:

    • Promoter engineering for context-appropriate expression levels

    • Codon optimization for enhanced translation efficiency

    • Signal peptide optimization if targeting or localization is critical

  • Testing and Validation:

    • Measurement of photosynthetic parameters in engineered strains

    • Growth assays under relevant environmental conditions

    • Biochemical characterization of purified engineered complexes

P. tricornutum has been successfully used as a chassis for expressing and secreting engineered proteins, such as PETase for polyethylene terephthalate degradation . Similar approaches could be applied to express modified petD variants, particularly in strains where the native petD has been knocked out.

What are the applications of recombinant petD protein in studying diatom adaptation to climate change?

Recombinant petD protein serves as a valuable tool for investigating diatom responses to climate change factors:

  • Thermal Adaptation Studies:

    • In vitro stability assays comparing petD proteins from different thermal environments

    • Electron transport measurements under temperature gradients

    • Structure-function analysis of thermally-adapted variants

  • Ocean Acidification Research:

    • Effects of pH on recombinant petD stability and function

    • Comparison of petD sequences from diatoms adapted to different pH environments

    • Identification of pH-sensitive residues through site-directed mutagenesis

  • Interaction with Nutrient Limitation:

    • How iron limitation affects petD expression and function

    • Silicate stress effects on photosynthetic complex assembly

    • Combined effects of multiple stressors on electron transport capacity

  • Evolutionary Studies:

    • Ancestral sequence reconstruction to understand evolutionary trajectories

    • Comparative analysis of petD from different diatom species

    • Identification of selection signatures in response to historical climate shifts

Proteomic studies have already identified key proteins (rbcL, PRK, atpB, DNA-binding, and signal transduction) as biomarkers induced by temperature and silicate stress in diatoms . Similar approaches could position petD within this broader stress response network.

How does petD contribute to Phaeodactylum tricornutum's unique carbon concentration mechanisms under low CO2 conditions?

Investigating petD's role in carbon concentration requires mechanistic studies:

  • Connection to Carbon Concentration Mechanisms (CCMs):

    • Analysis of electron transport rates alongside CCM component expression

    • Investigation of potential physical or functional linkages between petD and bicarbonate transporters

    • Assessment of how electron transport limitations affect CCM efficiency

  • Relationship with Alternative Carbon Fixation Pathways:

    • Study of petD expression alongside PEPC (phosphoenolpyruvate carboxylase) activity

    • Analysis of how altered electron transport affects C4-like carbon fixation pathways

    • Measurements of carbon isotope discrimination in petD mutants

  • Energetic Considerations:

    • Quantification of ATP/NADPH production ratios in wild-type versus petD-modified strains

    • Assessment of how these ratios affect carbon concentration capacity

    • Analysis of cyclic electron flow contribution to ATP generation for bicarbonate pumping

Research has shown that in P. tricornutum, a mitochondrial PEPC2 contributes to carbon fixation at low inorganic carbon concentrations . The potential interaction between this biochemical CCM and electron transport components like the cytochrome b6-f complex represents an important area for future investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.