Recombinant Phaeodactylum tricornutum Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Phaeodactylum tricornutum Photosystem I Assembly Protein Ycf4

The Photosystem I (PSI) assembly protein Ycf4, particularly in the diatom Phaeodactylum tricornutum, is a crucial component in the assembly and stabilization of the PSI complex . PSI is a large multiprotein complex embedded in the thylakoid membranes of chloroplasts, essential for converting light energy into redox energy during photosynthesis . Ycf4 acts as an auxiliary factor that facilitates the integration of peripheral PSI subunits and light-harvesting complexes (LHCIs) into the PSI reaction center subcomplex .

Function and Role of Ycf4

Ycf4 plays a significant role in the assembly process of Photosystem I (PSI) . It is involved in integrating both core subunits and light-harvesting complex I (LHCI) proteins into the PSI reaction center . Studies indicate that Ycf4 interacts with newly synthesized PSI proteins, aiding their assembly into a functional complex .

  • Assembly Mediator Ycf4 acts as a mediator in the assembly of the PSI-LHCI complex .

  • Stabilization It stabilizes the PSI complex by facilitating the correct integration of its subunits .

  • Pigment Association Ycf4 assists in associating pigments like chlorophylls and carotenoids with PSI proteins to form a functional holocomplex .

Ycf4 in Phaeodactylum tricornutum

In Phaeodactylum tricornutum, Ycf4 is essential for the efficient assembly and function of PSI . The diatom Phaeodactylum tricornutum has a high allocation of total protein to D1 and an active D1-repair cycle to limit photoinhibition .

Interaction with Other Proteins

Ycf4 interacts with other proteins, such as Ycf3 and Y3IP1, to form modules that mediate PSI assembly .

  • Ycf3-Y3IP1 Module This module primarily facilitates the assembly of reaction center subunits .

  • Ycf4 Module This module facilitates the integration of peripheral PSI subunits and LHCIs into the PSI reaction center subcomplex .

Experimental Evidence

Affinity purification and pulse-labeling experiments have provided evidence for Ycf4's role in PSI assembly . When HA-Ycf4 was purified from cells of which total cellular proteins had been pulse labeled, the chloroplast-encoded PsaA, PsaB, and PsaC, as well as the nuclear-encoded PSAD, PSAF, and PSAL were labeled .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
ycf4
Target Protein Sequence
MQNEIRQDKIIGSRRFSNYFWAFFLLVGGLGFLLAGISSYFKVNLLPFTNTTELVFIPQG LVMMFYGALSLGISIYTLLTIILDIGSGYNEYNRIENLVKVVRKGFPGKNREILLTYSLS NVRAIGIKITEGLNPTRSIYLCLKDERNIPLTPVQEPTAISNLEEEATDLAKFLDLRLEN L
Uniprot No.

Target Background

Function
Plays a crucial role in the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of Ycf4 protein in photosystem I assembly?

Ycf4 is a thylakoid protein that plays an essential role in the accumulation of photosystem I (PSI) in photosynthetic organisms. Research indicates that Ycf4 functions as a scaffold for PSI assembly, mediating the interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex. Studies using pulse-chase protein labeling have demonstrated that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, suggesting its pivotal role in the initial assembly steps of PSI .

How does Ycf4 function differ between P. tricornutum and other photosynthetic organisms?

While Ycf4 is essential for PSI accumulation in Chlamydomonas reinhardtii, its requirement varies across photosynthetic organisms. In cyanobacteria, mutants deficient in Ycf4 can still assemble the PSI complex, albeit at reduced levels . This functional divergence suggests evolutionary adaptations in PSI assembly mechanisms. In P. tricornutum, the characterization of Ycf4 remains less comprehensive compared to C. reinhardtii, with ongoing research focusing on its specific role in diatom photosynthesis and potential applications in recombinant protein production systems.

What protein complexes does Ycf4 form in vivo?

Biochemical studies have revealed that Ycf4 forms a large complex exceeding 1500 kD. In C. reinhardtii, this complex contains the opsin-related protein COP2 and several PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as identified through mass spectrometry (liquid chromatography-tandem mass spectrometry) and immunoblotting techniques . Electron microscopy analysis has shown that the largest structures in purified Ycf4-containing preparations measure approximately 285 × 185 Å, potentially representing several large oligomeric states .

What strategies can be employed to optimize recombinant Ycf4 expression in P. tricornutum?

Optimizing recombinant Ycf4 expression in P. tricornutum requires careful consideration of several factors. Selection of appropriate endogenous promoters is critical; research indicates that while the widely used fucoxanthin chlorophyll-binding protein A (fcpA) promoter shows peak expression at the log phase, the glutamine synthetase (GS) promoter can drive constitutive expression throughout all growth phases regardless of culture conditions . To enhance protein production, incorporating a minimal Kozak sequence (ACC) directly before the initial ATG codon has proven effective . Additionally, strategic codon optimization and fusion with reporter genes such as YFP or GFP facilitates the quantification of expression efficiency and protein accumulation .

How can researchers effectively isolate and characterize the Ycf4-containing complex?

The isolation and characterization of the Ycf4-containing complex can be achieved through a multi-step approach. Tandem affinity purification (TAP) tagging of Ycf4 has been successfully employed to purify stable Ycf4-containing complexes. The process typically involves:

  • Fusion of a TAP-tag to the C-terminus of Ycf4

  • Solubilization of thylakoid membranes with n-dodecyl-β-d-maltoside (DDM)

  • Two-step affinity column chromatography using IgG agarose

  • Sucrose gradient ultracentrifugation for size separation

  • Ion exchange column chromatography for further purification

Prior to immunoblotting analysis, the TAP-tagged Ycf4 can be digested with TEV protease to remove the protein A domain in the TAP-tag, allowing for more accurate quantification . Verification of complex integrity can be assessed through fluorescence induction kinetics of dark-adapted cells to confirm PSI activity .

What are the challenges in distinguishing between Ycf4's structural and functional roles in P. tricornutum?

Distinguishing between the structural and functional roles of Ycf4 in P. tricornutum presents several challenges. The protein may have dual functions: as a scaffold for PSI assembly and potentially in thylakoid membrane organization. Research approaches should include:

  • Generation of site-directed mutants that specifically disrupt protein-protein interactions versus membrane association

  • Time-resolved studies of PSI assembly incorporating pulse-chase labeling combined with immunoprecipitation

  • In vivo protein-protein interaction studies using techniques such as bimolecular fluorescence complementation or split-ubiquitin assays

  • Comparative analysis with other diatom species to identify conserved functional domains

Such comprehensive analyses would help discriminate between Ycf4's direct roles in PSI assembly and its potential indirect effects on thylakoid membrane organization that may influence photosynthetic efficiency in P. tricornutum.

What transformation protocols are most effective for introducing recombinant Ycf4 constructs into P. tricornutum?

Effective transformation of P. tricornutum with recombinant Ycf4 constructs requires optimization of several parameters. Based on experimental data, transforming stationary phase cells has shown success. The following protocol has demonstrated effectiveness:

  • Prepare cells in stationary phase for transformation

  • Use zeocin (100 μg/ml) as a selection marker in f/2 agar medium

  • Include the N-acetyl transferase gene (NAT) under fucoxanthin chlorophyll a/c-binding protein C promoter and terminator (FcpC) sequences as a selection marker

  • Verify transformants through both PCR analysis and fluorescence detection if using a fluorescent reporter

  • Select multiple colonies for further analysis to account for variable expression levels

Research has shown that transformation efficiency can vary significantly between constructs. For instance, the GS-501pro:GFP construct resulted in 175 zeocin-resistant colonies, while other constructs showed relatively lower numbers . Typically, approximately 72% of zeocin-resistant colonies contain the appropriate promoter and gene of interest, with about 42% expressing detectable levels of the reporter protein .

How should experiments be designed to evaluate the impact of environmental conditions on Ycf4 function?

Designing experiments to evaluate environmental impacts on Ycf4 function requires a systematic approach:

Environmental FactorExperimental ApproachMeasurement Parameters
Light intensityCulture cells under low (10 μE·m⁻²·s⁻¹), medium (50 μE·m⁻²·s⁻¹), and high (1000 μE·m⁻²·s⁻¹) light conditionsCell growth, Ycf4 expression, PSI activity, complex stability
Nutrient availabilityVary nitrogen, phosphorus, or iron concentrationsPromoter activity, Ycf4 accumulation, PSI assembly efficiency
Salt stressTest various salt concentrationsComplex stability, protein-protein interactions
TemperatureExpose cultures to temperature ranges (10-30°C)Folding efficiency, assembly kinetics, activity

Control experiments should include wild-type cells and cells expressing tagged but functionally verified Ycf4 to distinguish between environmental effects on the protein itself versus impacts on the expression system. Time-course analyses are crucial, as studies have shown that promoter activities can vary significantly between growth phases .

What assays provide the most reliable quantification of Ycf4 expression and function?

Reliable quantification of Ycf4 expression and function can be achieved through multiple complementary approaches:

  • Protein Accumulation:

    • Western blot analysis using anti-Ycf4 antibodies (recommended dilution 1:1000)

    • Fusion with fluorescent reporters (YFP/GFP) for in vivo visualization and quantification

    • Mass spectrometry for absolute quantification

  • Functional Assays:

    • Fluorescence induction kinetics of dark-adapted cells to assess PSI activity

    • Pulse-chase protein labeling to monitor PSI assembly kinetics

    • Electron microscopy to visualize complex formation

    • Photoautotrophic growth assays under varied light conditions

  • Promoter Activity:

    • GFP reporter systems under different promoters and culture conditions

    • qRT-PCR for transcript quantification

When using fusion proteins, it is important to verify that the tag does not significantly affect protein function, as demonstrated in studies where TAP-tagged Ycf4 maintained PSI assembly capability despite reduced accumulation (75% decrease) .

What are the most effective protein extraction methods for isolating Ycf4 from P. tricornutum?

Extracting Ycf4 from P. tricornutum requires careful consideration of its membrane-associated nature. The following protocol has proven effective:

  • Harvest cells during optimal expression phase (dependent on promoter used)

  • Resuspend cell pellet in extraction buffer containing protease inhibitors

  • Disrupt cells using methods such as sonication or French press

  • Separate thylakoid membranes through differential centrifugation

  • Solubilize membranes with n-dodecyl-β-d-maltoside (DDM)

  • Apply extracts to appropriate purification columns

For immunoblotting analysis, it is critical to ensure complete solubilization of the membrane-bound Ycf4. When working with tagged versions (such as TAP-tagged Ycf4), additional steps may be necessary. For example, digestion with TEV protease to remove the protein A domain prior to immunoblotting improves quantification accuracy .

What strategies can overcome the challenges of expressing membrane-associated proteins like Ycf4 in P. tricornutum?

Expressing membrane-associated proteins in P. tricornutum presents unique challenges that can be addressed through several strategies:

  • Codon Optimization:

    • Adapt codon usage to P. tricornutum preferences to enhance translation efficiency

  • Signal Peptide Selection:

    • Include appropriate targeting sequences to ensure proper localization to thylakoid membranes

  • Expression System Optimization:

    • Select promoters based on desired expression pattern. For constitutive expression, the GS promoter shows robust performance throughout all growth phases

    • Incorporate minimal Kozak sequence (ACC) before the initial ATG codon

  • Fusion Strategies:

    • Design fusion proteins with careful consideration of linker sequences

    • Validate that the fusion does not disrupt membrane integration or protein function

  • Culture Conditions:

    • Optimize light intensity, nutrient availability, and growth phase for harvest based on the specific promoter used

When using the GapC1 promoter, harvesting during log phase is optimal, while the GS promoter maintains consistent expression levels regardless of growth phase .

How can researchers effectively detect and quantify protein-protein interactions involving Ycf4?

Detecting and quantifying protein-protein interactions involving Ycf4 requires approaches tailored to membrane protein complexes:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-Ycf4 antibodies for pull-down experiments

    • Confirm interactions through western blot analysis with antibodies against potential interaction partners

  • Tandem Affinity Purification (TAP):

    • Fuse Ycf4 with a TAP tag to enable two-step purification

    • Identify interaction partners through mass spectrometry analysis

  • Sucrose Gradient Ultracentrifugation:

    • Separate protein complexes by size

    • Analyze fractions by immunoblotting to determine co-migration patterns

  • In vivo Visualization:

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

    • Fluorescence resonance energy transfer (FRET) for quantitative analysis of proximity

  • Cross-linking Mass Spectrometry:

    • Use chemical cross-linkers to stabilize transient interactions

    • Identify interaction sites through mass spectrometry analysis

These approaches have successfully identified interactions between Ycf4 and PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) as well as with COP2 in C. reinhardtii , providing a methodological framework that can be adapted for P. tricornutum.

How does the structure and function of Ycf4 in P. tricornutum compare to other photosynthetic organisms?

Comparative analysis of Ycf4 across photosynthetic organisms reveals important evolutionary adaptations:

OrganismEssential for PSI AssemblyComplex SizeNotable Features
P. tricornutumUnder investigationNot fully characterizedPotential for biotechnological applications
C. reinhardtiiYes>1500 kDForms complex with COP2 and PSI subunits
CyanobacteriaNo, but enhances efficiencyNot fully characterizedPSI assembly occurs at reduced levels in Ycf4-deficient mutants

While structural information for P. tricornutum Ycf4 is limited, protein structure prediction and comparative genomics approaches can provide insights. For C. reinhardtii, electron microscopy has revealed that the Ycf4-containing complex forms structures measuring approximately 285 × 185 Å . These differences in complex architecture and function suggest evolutionary divergence in PSI assembly mechanisms that may relate to different ecological niches and photosynthetic strategies.

What emerging technologies could advance the study of Ycf4 in P. tricornutum?

Several emerging technologies hold promise for advancing Ycf4 research in P. tricornutum:

  • CRISPR-Cas9 Gene Editing:

    • Creation of precise mutations to study structure-function relationships

    • Development of conditional knockdown systems to study essential functions

  • Advanced Imaging Techniques:

    • Cryo-electron microscopy for high-resolution structural analysis of the Ycf4 complex

    • Super-resolution microscopy to visualize dynamic assembly processes in vivo

  • Synthetic Biology Approaches:

    • Design of minimal synthetic PSI assembly systems

    • Development of new bioengineering tools specific to P. tricornutum

  • Promoter Engineering:

    • Fine-tuning expression through synthetic promoter design based on characterized endogenous promoters like GS and GapC1

  • Metabolic Flux Analysis:

    • Integration of Ycf4 function into whole-cell metabolic models to understand systemic impacts of PSI assembly efficiency

These technologies, when combined with established biochemical and molecular biology techniques, will provide a more comprehensive understanding of Ycf4's role in P. tricornutum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.