Recombinant Phaeodactylum tricornutum Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
psaL
Target Protein Sequence
MANFIKPYNDDPFVGHLATPITSSAVTRAILQNLPAYRFGLTPLLRGLEIGLAHGYFLMG PFVKLGPLRDSEIGLLAGFLSTVGLIVILTLGLTIYGVAAFGQEKTQSSNENDLQTKKAW DQFKGGFFVGACGSAGFAFICLSSIPSFITN
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Phaeodactylum tricornutum and why is it valuable as a recombinant protein expression system?

Phaeodactylum tricornutum is a model diatom that has gained significant attention as a promising host for light-driven synthesis of heterologous proteins. This marine microalga offers several advantages as an expression platform:

  • Photoautotrophic growth requiring minimal nutrients

  • Unique eukaryotic post-translational modifications including optional glycosylation

  • Ability to target proteins into the culture medium

  • Well-established genetic engineering tools and sequenced genome

P. tricornutum has been successfully used to produce various recombinant proteins, including the Hepatitis B surface antigen and its respective human antibody, demonstrating its versatility as a biological factory . As a eukaryotic organism with a cell wall poor in silica, it also provides a suitable model for testing membrane penetrability of compounds .

What is the function of Photosystem I reaction center subunit XI (psaL) in photosynthesis?

The psaL subunit serves critical structural and functional roles within Photosystem I:

  • Forms part of the core structure of the PSI reaction center

  • Contributes to the stability of the PSI complex, particularly under stress conditions

  • Physically interacts with the PsaB reaction center subunit and peripheral subunits PSAL and PSAH

  • Helps maintain the proper orientation of electron transfer cofactors within PSI

  • Involved in the stabilization of the LHCII docking site, potentially affecting light harvesting

Studies on related PSI subunits have shown that these components are essential for proper electron flow through the photosynthetic electron transport chain. The psaL subunit specifically participates in the organization of PSI trimers in cyanobacteria and plays a role in the structural arrangement of light-harvesting complexes around PSI .

What culture conditions optimize recombinant protein expression in P. tricornutum?

Based on recent studies, the following parameters significantly affect recombinant protein expression in P. tricornutum:

ParameterOptimal ConditionEffect on Protein ExpressionReference
Temperature18°CMaintains optimal growth rate
Light70 μmol m⁻¹ s⁻¹, 12h:12h dark-light cycleSupports photosynthesis without photoinhibition
pHAlkaline-acidic pH shiftsRequired for diatom growth
Mediumf/2-Si mediumProvides essential nutrients
Growth phaseLog phase for fcpA and GapC1 promotersMaximum protein expression

Optimized conditions have been shown to increase recombinant yellow fluorescent protein (YFP) mean fluorescence intensity per cell by 4.2-fold (from 3.6 ± 0.6 to 15.4 ± 1.1) and total protein levels in the culture by 1.8-fold (from 123 ± 4 to 219 ± 9 μg L⁻¹) without affecting biomass production .

What transformation and selection protocols are most effective for P. tricornutum?

The most effective transformation and selection protocols for P. tricornutum include:

  • Transformation of stationary phase cells:

    • Typically performed using biolistic methods (gene gun) or electroporation

    • Constructs contain the gene of interest fused to appropriate promoters and selection markers

  • Selection using antibiotic resistance markers:

    • Zeocin resistance (100 μg/ml) is commonly used

    • Selection on f/2 agar followed by liquid culture

  • Alternative selection using auxotrophic markers:

    • ptUMPS auxotrophic selection marker provides an antibiotic-free alternative

    • Selection based on complementation of uracil auxotrophy

  • Verification of transformants:

    • PCR analysis to confirm integration (72% of zeocin-resistant colonies typically contain the appropriate promoter and target gene)

    • Expression analysis via fluorescence (when using reporter genes like GFP)

A faster selection protocol has been established by shortening the uracil starvation phase to 6 weeks, requiring 3 transfers at inoculum rates not higher than 10⁶ cells·mL⁻¹, which has produced stable expression for >18 months in standard f/2 medium without selective pressure .

How do different promoters affect recombinant psaL expression and what factors influence their activity?

Several promoters have been characterized for recombinant protein expression in P. tricornutum, each with distinct expression patterns:

PromoterExpression PatternSpecial CharacteristicsBest Application
fcpAHighest at log phaseLight-regulatedGeneral protein expression
GSConstitutive throughout all growth phasesIndependent of culture conditionsStable, continuous expression
GapC1Highest at log phaseReduced under light and nitrogen starvationGrowth phase-specific expression
Alkaline phosphataseInducible under phosphate depletionHigher yield (24.1 μg·L⁻¹) under phosphate replete conditions (<3.6 μM)Controlled expression

For psaL expression, the constitutive GS promoter would be advantageous when stable expression is desired, while the alkaline phosphatase promoter provides an inducible system with significantly higher yields. The choice of promoter should be based on experimental goals, as expression levels can vary significantly between promoters and culture conditions .

What molecular mechanisms affect recombinant protein stability in P. tricornutum and how can they be manipulated?

Recombinant protein stability in P. tricornutum is influenced by several factors:

  • Protein degradation pathways:

    • The ubiquitin-proteasome system contributes significantly to recombinant protein degradation

    • Newly synthesized proteins remain stable for up to 12 hours before degradation begins

  • Culture conditions affecting stability:

    • Temperature and light intensity influence protein folding and stability

    • pH shifts can affect protein conformation and degradation rates

    • Nitrogen availability impacts cellular protein turnover mechanisms

  • Strategies to enhance stability:

    • Use of protein inhibitors to prevent degradation

    • Co-expression of chaperones to assist proper folding

    • Fusion to stabilizing partners or localization tags

    • Optimization of codon usage for improved translation efficiency

Research has shown that mathematical modeling of these parameters can help detect the factors most significantly affecting biomass and recombinant protein production, allowing for targeted optimization strategies .

What techniques are most effective for quantifying and characterizing recombinant psaL in P. tricornutum?

Several techniques have proven effective for quantifying and characterizing recombinant proteins in P. tricornutum:

  • Protein quantification methods:

    • BCA protein assay (UV-VIS spectrophotometry at 595 nm)

    • Fluorescence measurements for fluorescent-tagged proteins

    • Western blotting with specific antibodies against the target protein or fusion tags

  • Characterization techniques:

    • SDS-PAGE for size verification (expected size of psaL: ~15-18 kDa)

    • Mass spectrometry for precise molecular weight determination and post-translational modification analysis

    • Circular dichroism for secondary structure assessment

  • Functional assays:

    • Analysis of PSI complex assembly via Blue Native-PAGE

    • Electron transport measurements to assess functional integration

    • Fluorescence spectroscopy to evaluate energy transfer efficiency

Recent proteogenomic analysis of P. tricornutum has unambiguously identified approximately 8300 genes and revealed 606 novel proteins, providing a rich resource for comparative analysis of recombinant protein expression .

How can researchers assess the structural integration and functional activity of recombinant psaL within the PSI complex?

Assessing the structural integration and functional activity of recombinant psaL within the PSI complex requires multiple complementary approaches:

  • Structural integration analysis:

    • Blue Native-PAGE to isolate intact PSI complexes

    • Immunoprecipitation with anti-psaL antibodies to verify interaction partners

    • Electron microscopy to visualize complex assembly

    • CN-PAGE to separate different PSI-LHCI supercomplexes

  • Functional activity assessment:

    • Flash absorption spectrophotometry to track electron transfer kinetics

    • Photosynthetic efficiency measurements (Fv/Fm)

    • P700 oxidation kinetics using absorption spectroscopy at 700 or 820 nm

    • State transition analysis to assess light harvesting complex interactions

  • Comparative analysis with wild-type:

    • Growth rate comparisons under various light conditions

    • Stress tolerance evaluation (high light, cold temperature)

    • Spectroscopic comparison of PSI absorption and fluorescence properties

Studies on related PSI subunits have shown that mutations can affect PSI stability during high-light and chilling stress and leaf senescence, providing valuable insights into potential functional assays for recombinant psaL .

What are the evolutionary implications of expressing recombinant diatom psaL in heterologous systems?

The expression of recombinant diatom psaL in heterologous systems has several evolutionary and functional implications:

  • Evolutionary conservation and divergence:

    • Diatom photosystems evolved through secondary endosymbiosis

    • PSI subunits show varying degrees of conservation across photosynthetic organisms

    • Functional compatibility between components from different evolutionary lineages can reveal conserved interaction domains

  • Comparative photosynthesis research:

    • Allows for direct comparison of PSI structure and function across diverse photosynthetic lineages

    • Helps identify adaptations specific to marine environments

    • Provides insights into the evolution of light-harvesting strategies

  • Hybrid photosystem engineering:

    • Creates opportunities for designing chimeric photosystems with enhanced properties

    • May reveal unexpected functional compatibilities between components from distant lineages

    • Potential for creating photosystems with expanded light-harvesting capabilities

Studies on the organization of light-harvesting complexes around photosystems in diatoms have shown specific Lhc proteins bound to PSI or PSII supercomplexes, indicating unique adaptations that could be leveraged in heterologous expression systems .

What are common challenges in expressing recombinant psaL in P. tricornutum and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant proteins like psaL in P. tricornutum:

ChallengePossible CausesSolutionsReference
Low expression levelsSuboptimal promoter, codon biasUse stronger promoters (GS), optimize codons for P. tricornutum
Protein instabilityProteasomal degradationAdd proteasome inhibitors, optimize culture conditions
Poor integration into PSIImproper folding, missing chaperonesCo-express interaction partners, optimize targeting sequences
Toxicity to host cellsDisruption of native PSI, ROS productionUse inducible promoters, express at lower levels
Difficulty in verificationLow abundance, lack of antibodiesUse fusion tags (His, GFP), develop specific detection methods

A multifactorial approach is often necessary, as demonstrated in recent studies where mathematical modeling was used to identify parameters affecting biomass and recombinant protein production, resulting in a 4.2-fold increase in protein expression .

How can researchers optimize growth conditions to maximize recombinant psaL yield while maintaining its functional properties?

Maximizing recombinant psaL yield while preserving functionality requires careful optimization of multiple parameters:

  • Light conditions optimization:

    • Moderate light intensity (70-100 μmol m⁻² s⁻¹) supports optimal growth

    • 12h:12h dark-light cycle maintains circadian rhythms

    • Blue light enrichment can enhance photosynthetic efficiency

  • Temperature regulation:

    • Maintain cultures at 18°C to support proper protein folding

    • Avoid temperature fluctuations that could stress cells

    • Consider temporary cold shock to induce stress response proteins that may aid folding

  • Nutrient formulation:

    • Use f/2 medium for balanced nutrient availability

    • Manipulate phosphate levels for inducible expression with the alkaline phosphatase promoter

    • Consider timing of nutrient depletion to coincide with maximum expression phase

  • Harvest timing optimization:

    • For constitutive promoters (GS), harvest after sufficient biomass accumulation

    • For growth phase-dependent promoters (fcpA, GapC1), harvest during log phase

    • For inducible systems, allow 12-24 hours post-induction before harvesting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.