Recombinant Phaeodactylum tricornutum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

The Recombinant Phaeodactylum tricornutum Photosystem Q(B) protein is a bioengineered version of a critical component in Photosystem II (PSII) of the diatom Phaeodactylum tricornutum. Native to this marine organism, the protein is also referred to as Photosystem II protein D1 (EC 1.10.3.9) or the 32 kDa thylakoid membrane protein. Its primary role in PSII involves acting as a secondary electron acceptor, facilitating electron transfer from the primary acceptor Q_A to the plastoquinone pool .

Key Features

PropertyDescription
EC Number1.10.3.9
UniProt IDA0T0G9
Source OrganismPhaeodactylum tricornutum strain CCAP 1055/1
Expression SystemYeast
Purity>85% (SDS-PAGE)

The protein is integral to PSII’s light-dependent reactions, serving as a binding site for the secondary quinone (Q_B) and stabilizing the oxygen-evolving complex (OEC). Its structural integrity is vital for maintaining PSII activity, as disruptions in this protein impair electron transport and increase light sensitivity .

Production and Purification

The recombinant protein is synthesized in yeast systems, leveraging heterologous expression to achieve high yield and purity. Key technical parameters include:

ParameterSpecification
Product CodeCSB-YP371399EUF1
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
Storage-20°C/-80°C (liquid or lyophilized)
Stability6 months (liquid), 12 months (lyophilized)

The protein is supplied in a Tris-based buffer with 50% glycerol to enhance stability. Repeated freeze-thaw cycles are discouraged, and working aliquots are stored at 4°C for short-term use .

Role in Photosynthetic Studies

The recombinant protein is employed to:

  1. Study PSII Function: Investigate electron transfer dynamics and the effects of environmental stressors (e.g., iron deficiency) on PSII efficiency .

  2. Antigen in ELISA Kits: Detect and quantify the protein in biochemical assays, aiding in structural or functional analysis .

  3. Mechanistic Insights: Elucidate interactions between Q_B and the S₂/S₃ states of the manganese cluster in the OEC, as observed in thermoluminescence (TL) studies .

Iron Deficiency Impact

Iron-limited P. tricornutum cultures show reduced PSII quantum yield (~38% decrease) and altered TL band intensities, though primary photochemistry (e.g., Q_B recombination) remains unaffected . This highlights the protein’s resilience to certain stressors.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Phaeodactylum tricornutum (strain CCAP 1055/1)
Target Names
psbA
Target Protein Sequence
MTATLERRQSVSLWERFCGWITSTENRLYIGWFGCLMFPTLLTATSCYIIAFIAAPPVDI DGIREPVAGSLLYGNNIITGAVIPSSNAIGIHFYPIWEAASVDEWLYNGGPYQLIVLHFL LGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPVVGIWLTAMGVSTMAFNLNGF NFNQSVVDSQGRVINTWADIINRADLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What makes Phaeodactylum tricornutum an ideal model organism for recombinant protein studies?

Phaeodactylum tricornutum is a pennate diatom with a fully sequenced 27.6 Mb genome consisting of 33 chromosomes containing 12,177 predicted protein-coding genes. As a model organism, it offers several advantages:

  • Complete genomic information enables precise genetic manipulation

  • Pleiomorphic nature with three convertible morphotypes (oval, fusiform, and triradiate)

  • Higher carbon fixation ability compared to other microalgae

  • Facultative requirement for silicic acid, simplifying laboratory culture

  • Extensive tools for genetic manipulation including gene overexpression, silencing, editing, and plasmid transformation

The combination of these features makes P. tricornutum particularly valuable for studying photosynthetic proteins, including those in Photosystem II.

What is the biochemical significance of the QB site in Photosystem II?

The QB site in Photosystem II (PSII) serves as the binding location for plastoquinone (PQ), which functions as the terminal electron acceptor in the photosynthetic electron transport chain. Key characteristics include:

  • Acts as part of the light-driven water/plastoquinone photooxidoreductase system

  • Accepts electrons from the primary quinone acceptor (QA)

  • Forms a semiquinone (QB- −) intermediate after accepting one electron

  • Becomes fully reduced to plastohydroquinone (QBH2) after accepting a second electron and two protons

  • Released QBH2 enters the membrane plastoquinone pool, allowing a new PQ molecule to bind

This electron transfer process is fundamental to photosynthetic energy conversion and is central to understanding PSII function.

What are the redox characteristics of QB in photosynthetic systems?

The redox properties of QB are critical for its function and can be quantified through midpoint potentials (Em). In PSII from Thermosynechococcus elongatus:

The difference between Em(QB/QBH2) and Em(PQ/PQH2) of approximately 50 meV represents the driving force for QBH2 release into the pool. Additionally, the large difference (~234 meV) between Em(QB/QB- −) and Em(QA/QA- −) provides substantial driving force for electron transfer from QA- − to QB .

What promoter systems are most effective for recombinant protein expression in P. tricornutum?

Recent research has identified the HASP1 (highly abundant secreted protein 1) promoter as particularly effective for recombinant protein expression in P. tricornutum:

PromoterExpression PatternAdvantagesBest Application
HASP1Strong expression throughout all growth phasesMaintains high expression in stationary phaseLong-term protein production
fcpAStrong in early growth, diminishes in stationary phaseWell-characterized, commonly usedShort-term expression studies

The HASP1 promoter has been validated using green fluorescent protein (GFP) as a reporter, demonstrating its effectiveness for stable, long-term recombinant protein expression .

How can researchers optimize protein secretion in P. tricornutum expression systems?

Efficient protein secretion in P. tricornutum can be achieved by utilizing appropriate signal peptides:

  • The HASP1 signal peptide has been demonstrated to facilitate efficient secretion of recombinant proteins

  • When fused to reporter proteins like GFP, the HASP1 signal peptide directs proper trafficking through the secretory pathway

  • This approach eliminates the need for cell lysis during protein recovery

  • The secretion system works effectively throughout different growth phases

This secretion strategy can be particularly valuable when expressing proteins that may be toxic intracellularly or when simplified downstream purification is desired .

What techniques are most reliable for measuring QB redox states in recombinant systems?

Several complementary techniques can be employed to assess QB redox states:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Directly detects the semiquinone radical (QB- −)

    • Provides quantitative measurements of redox couples

    • Allows determination of midpoint potentials

  • FTIR Spectroscopy:

    • Measures the ability to form QB- − upon flash illumination

    • Useful for monitoring QB functionality in intact systems

  • Thermoluminescence:

    • Provides functional estimates of the energy gap between QA and QB

    • Useful for examining pH dependence of electron transfer

Each method offers different advantages, and researchers should be aware that different techniques can sometimes yield conflicting results, necessitating careful interpretation .

How do culture conditions affect expression of photosystem components in P. tricornutum?

Culture conditions significantly impact photosystem component expression and function:

  • Light Conditions:

    • Intermittent light induces "super qE" (enhanced non-photochemical quenching) through LHCX1 upregulation

    • Different wavelengths induce differential expression of photosystem components

  • Silicon Availability:

    • Silicon enhances growth under challenging conditions (green light, low temperature)

    • Affects pigment composition and photosynthetic efficiency

    • Influences cellular morphology which may impact protein expression

  • Growth Phase:

    • Expression of photosystem components varies throughout the growth cycle

    • Stationary phase often shows reduced expression of some components

These factors should be carefully controlled and documented when designing experiments with recombinant photosystem proteins .

How should researchers address contradictory findings regarding QB redox properties?

Contradictory findings about QB redox properties in the literature require careful analysis:

  • Methodological differences:

    • Direct measurement (EPR) versus indirect approaches can yield different results

    • Ensure measurements target the bound QB rather than free plastoquinone

    • Consider sample preparation effects on quinone binding

  • Resolving contradictions:

    • Compare experimental conditions thoroughly (pH, temperature, detergents)

    • Assess whether measurements reflect QB or other quinones like free PQ

    • Consider species-specific differences when comparing across organisms

For example, a recent study reported QB redox behavior as an n=2 curve with Em=125 mV at pH 7, which contradicts findings showing thermodynamic stability of QB- −. This discrepancy may be explained by the measurement of free plastoquinone rather than bound QB .

How does LHCX1 activity in P. tricornutum affect interpretation of photosystem studies?

The activity of LHCX1 protein in P. tricornutum creates important considerations:

  • LHCX1 is constitutively upregulated under intermittent light conditions, forming "super qE"

  • This photoprotective mechanism is abolished in LHCX1 knockout mutants

  • Complementation of LHCX1 knockout with the genomic LHCX1 sequence restores qE function

  • The variable rescue of qE corresponds to different LHCX1 expression levels in independent complemented lines

These findings indicate that LHCX1 levels must be monitored when studying photosystem function in P. tricornutum, as variations in LHCX1 expression can significantly impact experimental outcomes and interpretation .

What factors impact the stability of QB- − and how does this influence experimental design?

The semiquinone QB- − shows remarkable stability that affects experimental approaches:

  • Thermodynamic stability:

    • High potential (Em ≈ 90 mV) makes QB- − a poor reductant for O2

    • Results in very long lifetime in the dark (half-times of hours)

    • Contradicts suggestions that QB- − may be a significant source of reactive oxygen species

  • Experimental implications:

    • Long-term measurements of QB- − are feasible due to its stability

    • Redox titrations can reliably detect thermodynamically stable QB- −

    • Different species (bacterial reaction centers, diatoms) show similar QB- − stabilization despite varying exact potentials

These properties of QB- − stability are consistent across multiple photosynthetic organisms and should inform experimental design, especially for long-duration measurements .

How can LHCX1 knockout systems advance studies of recombinant QB protein interactions?

LHCX1 knockout systems in P. tricornutum offer sophisticated research opportunities:

  • Experimental platform:

    • LHCX1 knockouts exhibit optimal growth similar to wild-type cells

    • Complementation with varying LHCX1 expression levels creates a tunable system

    • Random insertion of complementation constructs provides diverse expression patterns

  • Research applications:

    • Study QB redox behavior in the absence of photoprotective mechanisms

    • Investigate interactions between electron transport and photoprotection

    • Examine how altered LHCX1 levels affect QB function

    • Test recombinant QB variants in different photoprotective backgrounds

This experimental system allows researchers to isolate the effects of photoprotection on electron transport through the QB site and better understand their mechanistic relationship .

What are the implications of differential quinone binding for engineering enhanced photosystems?

Understanding the differential binding of quinones at the QB site offers engineering opportunities:

  • Binding characteristics:

    • PQ binds approximately 50× more tightly than PQH2 at the QB site

    • This differential binding provides a ~50 meV driving force for QBH2 release

    • Optimizes PSII function even in the presence of a largely reduced plastoquinone pool

  • Engineering applications:

    • Modifying binding site residues could alter quinone affinity

    • Adjusting the binding differential could optimize electron flow rates

    • Engineering systems with enhanced tolerance to high reduction states

    • Creating variants with altered specificity for different quinone types

These principles could inform the design of photosystems with improved efficiency or novel functional properties in recombinant systems .

How do pigment-protein interactions in diatoms inform recombinant photosystem design?

The unique pigment-protein interactions in diatoms provide important design considerations:

  • LHCX1 pigment binding characteristics:

    • LHCX1 may differ from other light-harvesting proteins in pigment binding

    • Possibility of transient pigment binding or no pigment binding at all

    • Mutagenesis of putative protonatable residues (D95 and E205) affects function

  • Design implications:

    • Recombinant systems may need to account for different pigment-binding requirements

    • Functional analysis should consider both protein and pigment components

    • Engineering efforts may benefit from understanding the structural basis of these interactions

These distinctive aspects of diatom photosystems can inform the development of novel recombinant systems with enhanced or specialized functions .

What methodological approaches can resolve contradictions in QB redox measurements?

Advanced methodological approaches to resolve contradictions in QB measurements include:

  • Combined spectroscopic techniques:

    • Parallel EPR and FTIR measurements on the same samples

    • Cross-validation with thermoluminescence data

    • Correlation with functional measurements of electron transfer

  • Site-directed mutagenesis approaches:

    • Systematic modification of residues involved in quinone binding

    • Creation of variants with altered binding properties

    • Correlation of binding site changes with redox potential shifts

  • Comparative analyses across species:

    • Systematic comparison of QB properties in different photosynthetic organisms

    • Identification of conserved versus variable features

    • Correlation of differences with structural variations

These approaches can help distinguish between intrinsic QB properties and measurement artifacts, leading to more accurate models of QB function in photosynthetic systems .

What emerging technologies could enhance recombinant photosystem studies in P. tricornutum?

Several emerging technologies show promise for advancing research in this field:

  • CRISPR-Cas9 gene editing:

    • Precise modification of native photosystem genes

    • Creation of tagged proteins for in vivo tracking

    • Development of regulatable expression systems

  • Advanced imaging techniques:

    • Super-resolution microscopy for tracking protein localization

    • Live-cell imaging of electron transport processes

    • Correlative light and electron microscopy for structural insights

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Systems biology approaches to understand regulatory networks

    • Prediction of optimal conditions for recombinant expression

These technologies could significantly enhance our ability to study and engineer photosystem components in P. tricornutum .

How might silicon-dependent regulation mechanisms be leveraged in recombinant systems?

The silicon-dependent regulation in P. tricornutum offers unique opportunities:

  • Environmental responsiveness:

    • Silicon enhances growth under green light and low temperature

    • Silicon starvation leads to differential expression of miRNAs

    • These regulatory mechanisms could be harnessed for conditional expression

  • Potential applications:

    • Development of silicon-responsive promoter systems

    • Creation of environmentally-tunable expression platforms

    • Engineering of stress-resistant recombinant strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.