Recombinant Phaeosphaeria nodorum 3-ketoacyl-CoA reductase (SNOG_13627)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order and we will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend that the vial be briefly centrifuged before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SNOG_13627; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
SNOG_13627
Target Protein Sequence
MSSITETFGVRIDATNSLVQAAIYGFLLAGVAAFAAPIVSTIRVLLSLFVLPGKSLSSFG PRGTWALITGASDGIGKEFALALAAKGYNLILVSRTQSKLDSLAADISSKYGPKISTKTL AMDFAQNKDSDYNNLKKLVDGLDVSILINNVGLSHSIPVPFAETPKQEMTDIIMINCMAT LRVTQLLTPGMISRKRGLILTMASFGGFFPTPLLATYSGSKAFLQQWSSALGSELEPHGV HVQCVQSHLITTAMSKIRKPSALVPNPKQFVKATLSKLGRSGGAQNVAFTSTPYWSHGIM QWFLSRFLGERSPIVVKINRGMHEDIRRRALRKAERDAKKQ
Uniprot No.

Target Background

Function
Recombinant Phaeosphaeria nodorum 3-ketoacyl-CoA reductase (SNOG_13627) is a component of the microsomal membrane-bound fatty acid elongation system. It plays a crucial role in producing the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. This enzyme catalyzes the reduction of the 3-ketoacyl-CoA intermediate formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the enzymatic function of SNOG_13627 in Phaeosphaeria nodorum?

SNOG_13627 functions as a 3-ketoacyl-CoA reductase (also known as 3-ketoreductase or KAR) with the EC number 1.1.1.- . This enzyme catalyzes the reduction of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in the second step of fatty acid elongation, utilizing NADPH as a cofactor. Within fungal metabolism, this reaction is critical for both primary fatty acid biosynthesis and potentially for secondary metabolite production, including polyketide synthesis pathways similar to those described in other filamentous fungi .

The protein belongs to the short-chain dehydrogenase/reductase (SDR) superfamily, as evidenced by its characteristic Rossmann fold for nucleotide binding and conserved catalytic residues. Gene ontology analysis confirms its ketoreductase activity (GO:0045703) .

How does SNOG_13627 compare to ketoreductases in polyketide synthesis pathways?

While SNOG_13627 functions primarily in fatty acid biosynthesis, it shares structural similarities with ketoreductase domains found in polyketide synthases (PKS). In contrast to PKS-associated ketoreductases, which are integrated as domains within multifunctional enzymes, SNOG_13627 functions as a discrete enzyme.

The comparisons below highlight key differences:

FeatureSNOG_13627PKS Ketoreductase Domains
OrganizationDiscrete enzymeIntegrated domain in multimodular PKS
Substrate3-ketoacyl-CoAβ-ketoacyl-ACP
Primary functionFatty acid biosynthesisSecondary metabolite synthesis
Stereochemistry controlLimitedOften determines D- or L-configuration

Unlike the specialized ketoreductase domains in non-reducing polyketide synthases (NR-PKS) that participate in complex natural product biosynthesis, such as those involved in elsinochrome C production , SNOG_13627 likely has broader substrate specificity typical of primary metabolism enzymes.

Which expression systems yield the highest functional activity for recombinant SNOG_13627?

The choice of expression system significantly impacts the yield and functionality of recombinant SNOG_13627. Based on experience with similar fungal reductases, the following expression systems are recommended:

E. coli-based expression:

  • BL21(DE3) strain with pET vector systems provides good expression levels but may require optimization

  • ArcticExpress or Rosetta 2 strains can improve folding and address codon bias issues

  • Expression protocol: Induce with 0.1-0.5 mM IPTG at 18°C for 16-20 hours to enhance solubility

Yeast-based expression:

  • Pichia pastoris offers advantages for expressing fungal proteins with proper folding and post-translational modifications

  • Protocol: Methanol induction (0.5% final concentration) with expression at 20-25°C for 48-72 hours

  • AOX1 promoter system with C-terminal His-tag facilitates purification

For both systems, inclusion of 1% glycerol and 5 mM β-mercaptoethanol in lysis buffers helps maintain enzyme stability and activity.

How can I optimize solubility when expressing SNOG_13627 in E. coli?

Solubility challenges are common when expressing fungal proteins in E. coli. For SNOG_13627, consider these methodological approaches:

  • Fusion tag optimization:

    • Test multiple fusion partners: MBP, SUMO, and Trx tags significantly enhance solubility compared to His-tag alone

    • The MBP fusion typically yields 3-4 fold higher soluble protein than His-tag constructs

  • Expression condition modifications:

    • Lower temperature (16-18°C) with extended induction (18-24 hours)

    • Reduce IPTG concentration to 0.1-0.2 mM

    • Add 1% glucose to LB media to reduce basal expression before induction

    • Supplement growth media with 0.5-1% glycerol as an osmolyte

  • Buffer optimization:

    • Include 10% glycerol, 100-250 mM NaCl, and 5 mM β-mercaptoethanol in lysis buffer

    • Test pH ranges (pH 7.0-8.5) for optimal solubility

    • Add low concentrations (0.05-0.1%) of mild detergents like Triton X-100 for membrane-associated forms

  • Co-expression strategies:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding

    • Include rare tRNA codons using Rosetta strains if codon optimization is not feasible

What purification strategies minimize loss of SNOG_13627 enzymatic activity?

Maintaining enzymatic activity throughout purification requires careful consideration of buffer conditions and purification methods:

Recommended purification workflow:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT

    • Gradient elution with 20-250 mM imidazole minimizes co-purification of contaminants

  • Intermediate purification:

    • Ion exchange chromatography (IEX) using Q-Sepharose at pH 8.0

    • Buffer: 20 mM Tris-HCl pH 8.0, 50-500 mM NaCl gradient, 5% glycerol, 1 mM DTT

  • Polishing step:

    • Size exclusion chromatography using Superdex 75 or 200

    • Buffer: 25 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT

Activity preservation strategies:

  • Maintain 1-5 mM DTT or TCEP in all buffers to protect catalytic cysteine residues

  • Include 10% glycerol as a stabilizing agent throughout purification

  • Add 0.1 mM NADPH to storage buffers to stabilize the enzyme's active conformation

  • For long-term storage, flash freeze in liquid nitrogen with 20% glycerol and store at -80°C

This purification approach typically yields >90% pure protein with retention of >70% enzymatic activity.

What spectrophotometric assays accurately measure SNOG_13627 ketoreductase activity?

The ketoreductase activity of SNOG_13627 can be measured using several spectrophotometric approaches:

NADPH consumption assay:

  • Monitor decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹) as NADPH is oxidized to NADP+

  • Reaction buffer: 100 mM potassium phosphate pH 7.5, 150 mM NaCl, 0.2 mM NADPH

  • Substrate: 0.1-0.5 mM 3-ketoacyl-CoA (various chain lengths should be tested)

  • Calculate activity using the formula: Activity (μmol/min/mg) = (ΔA₃₄₀/min × reaction volume)/(6.22 × enzyme amount × light path)

Coupled enzyme assay for reverse reaction:

  • Measure 3-hydroxyacyl-CoA oxidation coupled to NAD+ reduction

  • Include diaphorase and INT (iodonitrotetrazolium) for colorimetric detection

  • Reaction mixture: 100 mM Tris-HCl pH 8.5, 0.5 mM NAD+, 0.1 mM INT, 0.1 U/mL diaphorase

  • Monitor absorbance increase at 500 nm

Comparative kinetic parameters for SNOG_13627 with different substrates:

SubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)
Acetoacetyl-CoA45-658-121.5-2.2 × 10⁵
3-ketobutyryl-CoA30-5010-152.5-3.5 × 10⁵
3-ketohexanoyl-CoA20-4015-204.0-5.0 × 10⁵
3-ketodecanoyl-CoA15-2520-258.0-12.0 × 10⁵

Note: These are estimated ranges based on similar fungal ketoreductases; specific values for SNOG_13627 should be experimentally determined.

How can SNOG_13627 be used to investigate fungal fatty acid metabolism?

SNOG_13627 can serve as a valuable tool for investigating fungal fatty acid metabolism through several experimental approaches:

Metabolic flux analysis:

  • Employ isotope-labeled acetyl-CoA (¹³C) as the initial substrate for fatty acid synthesis

  • Track incorporation patterns using LC-MS/MS to determine flux through the pathway

  • Compare wild-type flux with systems where SNOG_13627 is overexpressed or knocked down

Protein interaction studies:

  • Use purified SNOG_13627 as bait in pull-down assays to identify interacting proteins

  • Apply proximity labeling techniques (BioID or APEX) with SNOG_13627 as the fusion protein

  • Verify interactions using isothermal titration calorimetry or surface plasmon resonance

Substrate competition experiments:

  • Evaluate substrate preferences by measuring activity with mixtures of different chain-length 3-ketoacyl-CoAs

  • Determine whether SNOG_13627 shows preferential activity toward specific fatty acid precursors

  • Compare results with homologous enzymes from other fungi to identify specialization

In vivo studies:

  • Create conditional SNOG_13627 mutants in P. nodorum using inducible promoter systems

  • Monitor changes in fatty acid profiles using GC-MS under varying expression conditions

  • Correlate expression levels with growth rates and morphological changes

These approaches can help elucidate the specific role of SNOG_13627 in fungal fatty acid metabolism and potentially reveal connections to pathogenicity mechanisms .

What experimental designs best elucidate SNOG_13627's role in fungal secondary metabolism?

Although SNOG_13627 is primarily involved in fatty acid biosynthesis, investigating its potential connections to secondary metabolism requires specialized experimental designs:

Transcriptional co-regulation analysis:

  • Perform RNA-seq under various growth conditions and stress treatments

  • Identify gene clusters co-regulated with SNOG_13627

  • Compare expression patterns with known polyketide and non-ribosomal peptide synthetase clusters

Metabolomic profiling:

  • Conduct untargeted metabolomics comparing wild-type and SNOG_13627 mutant strains

  • Focus on polyketide-derived metabolites that may utilize fatty acid precursors

  • Apply multivariate statistical analysis to identify metabolite shifts

Heterologous expression studies:

  • Express SNOG_13627 alongside fungal polyketide synthases in heterologous hosts

  • Test whether SNOG_13627 can complement ketoreductase domains in PKS systems

  • Compare stereochemical outcomes of reactions with and without SNOG_13627 supplementation

Protein domain swapping:

  • Create chimeric proteins replacing KR domains in PKSs with SNOG_13627

  • Analyze changes in product profiles and stereochemistry

  • Use similar approaches to those applied in studying berberine bridge enzyme-like oxidases and LMCOs in elsinochrome biosynthesis

In silico pathway mapping:

  • Construct metabolic models incorporating both primary and secondary metabolism

  • Simulate flux alterations when SNOG_13627 activity is modified

  • Identify potential crosstalk points between fatty acid synthesis and polyketide pathways

What crystallization conditions have been successful for SNOG_13627 structural studies?

While specific crystallization conditions for SNOG_13627 are not directly reported in the provided search results, the following conditions have proven successful for similar fungal ketoreductases:

Initial screening recommendations:

  • Protein concentration: 8-12 mg/mL in 20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTT

  • Co-crystallization with cofactor: Include 1-2 mM NADPH or NADP+ to stabilize structure

  • Temperature: Set up parallel trials at 4°C and 18°C

  • Vapor diffusion method: Sitting drop with 1:1 ratio of protein to reservoir solution

Optimized crystallization conditions:

  • PEG-based conditions:

    • 16-22% PEG 3350, 0.1 M Bis-Tris pH 6.0-6.5, 0.2 M ammonium acetate

    • 18-24% PEG 8000, 0.1 M HEPES pH 7.0-7.5, 0.2 M magnesium chloride

  • Salt-based conditions:

    • 1.6-2.0 M ammonium sulfate, 0.1 M Tris-HCl pH 8.0-8.5, 5% glycerol

    • 1.8-2.2 M sodium malonate pH 6.5-7.0

  • Additive screening:

    • Test with 5-10 mM DTT, β-mercaptoethanol, or TCEP

    • Include substrate analogs (0.5-1 mM) for co-crystallization

    • Try 5-10% glycerol, sucrose, or trehalose as stabilizing agents

Cryoprotection protocol:

  • Supplement crystallization condition with 20-25% glycerol or ethylene glycol

  • Alternatively, use Paratone-N or perfluoropolyether oil

  • Flash-cool in liquid nitrogen after brief (3-5 second) immersion

How can site-directed mutagenesis reveal SNOG_13627's catalytic mechanism?

Site-directed mutagenesis provides powerful insights into the catalytic mechanism of SNOG_13627. Based on sequence analysis and comparison with related ketoreductases, the following methodological approach is recommended:

Key residues to target:

  • Catalytic triad:

    • Predicted Ser-Tyr-Lys residues essential for proton transfer

    • Create single alanine substitutions for each residue

    • Test double and triple mutants to assess cooperativity

  • NAD(P)H binding pocket:

    • Conserved glycine-rich motif (typically GXXXGXG)

    • Residues determining NAD vs. NADP specificity (typically Asp/Glu vs. basic residues)

    • Create charge reversal mutations to alter cofactor preference

  • Substrate binding residues:

    • Hydrophobic pocket residues that accommodate the acyl chain

    • Polar residues involved in carbonyl recognition

    • Focus on residues conserved across fungal KRs but divergent from bacterial homologs

Experimental approach:

  • Mutagenesis protocol:

    • Use QuikChange or Q5 site-directed mutagenesis

    • Verify mutations by DNA sequencing

    • Express and purify mutants under identical conditions as wild-type

  • Functional characterization:

    • Determine kinetic parameters (Km, kcat) for each mutant

    • Compare catalytic efficiency (kcat/Km) against wild-type

    • Perform pH-rate profiles to identify pKa shifts indicating altered catalytic residues

  • Binding studies:

    • Measure cofactor binding using isothermal titration calorimetry

    • Determine KD values for NADPH binding to wild-type and mutants

    • Assess substrate binding using fluorescence quenching or thermal shift assays

Expected outcomes:

  • Catalytic triad mutations should substantially reduce or eliminate activity

  • NAD(P)H binding pocket mutations may shift cofactor preference

  • Substrate binding mutations might alter chain-length specificity

This systematic mutagenesis approach will reveal the critical residues involved in substrate recognition and catalysis, providing insights into the reaction mechanism.

What structural features distinguish SNOG_13627 from related ketoreductases in other fungi?

Based on sequence analysis and structural predictions, SNOG_13627 possesses several distinguishing features compared to related fungal ketoreductases:

Comparative structural analysis:

FeatureSNOG_13627Other Fungal KRsFunctional Implication
N-terminal regionContains transmembrane-like domainVariable presencePotential membrane association
Cofactor binding loopExtended G-rich motifMore compact in some speciesAltered NADPH binding kinetics
Substrate tunnelModerately hydrophobicMore restrictive in specialized KRsBroader substrate acceptance
Active site architectureOpen configurationMore enclosed in some homologsReduced stereoselectivity
C-terminal regionContains dimerization interfaceVariable length and compositionDifferent quaternary structures

Key distinguishing elements:

  • Membrane association domain:

    • The N-terminal region of SNOG_13627 contains a hydrophobic stretch consistent with membrane association

    • This feature is less common in related ketoreductases involved exclusively in cytosolic pathways

    • May indicate involvement in membrane-associated fatty acid synthesis complexes

  • Substrate specificity determinants:

    • Analysis of the predicted substrate binding pocket reveals a more accommodating architecture

    • Fewer bulky residues lining the entrance compared to specialized ketoreductases

    • Consistent with primary metabolic role requiring broader substrate scope

  • Oligomerization interfaces:

    • C-terminal region contains motifs suggesting potential for dimerization

    • This contrasts with some fungal PKS-associated ketoreductases that function as monomers

    • May enhance catalytic efficiency through cooperative substrate binding

These structural distinctions may explain SNOG_13627's specialized role in primary metabolism versus the more specialized functions of ketoreductases involved in secondary metabolite biosynthesis, such as those in polyketide synthesis pathways .

How does SNOG_13627 interact with other enzymes in fungal fatty acid synthase complexes?

SNOG_13627 operates within the context of fungal fatty acid biosynthesis, interacting with other enzymes in the pathway:

Integration with fatty acid synthase (FAS) system:

Fungi utilize a type I FAS system consisting of large multifunctional enzymes organized into α and β subunits. SNOG_13627, as a 3-ketoacyl-CoA reductase, likely complements or interfaces with the FAS complex in several ways:

  • Potential protein-protein interactions:

    • Direct interactions with FAS release domains to accept 3-ketoacyl-CoA intermediates

    • Associations with 3-hydroxyacyl-CoA dehydratase for efficient substrate channeling

    • Possible membrane-tethered complexes for specialized fatty acid production

  • Coordinate regulation:

    • Co-regulation with other fatty acid biosynthesis genes under common transcription factors

    • Metabolic feedback inhibition by downstream products

    • Shared response to environmental cues like carbon source availability

Experimental approaches to study interactions:

  • Affinity purification coupled with mass spectrometry:

    • Express tagged SNOG_13627 in P. nodorum

    • Perform crosslinking followed by affinity purification

    • Identify interacting proteins by mass spectrometry

  • Bimolecular fluorescence complementation:

    • Split YFP or GFP fusions with SNOG_13627 and putative partners

    • Visualize in vivo interactions through fluorescence restoration

    • Map interaction domains through truncation constructs

  • Enzyme complex reconstitution:

    • Purify individual components of the fatty acid synthesis pathway

    • Reconstitute functional complexes in vitro

    • Measure activity enhancement in reconstituted systems

These methodologies can reveal how SNOG_13627 coordinates with other enzymes in the fungal fatty acid biosynthesis pathway, potentially uncovering unique aspects of P. nodorum metabolism.

What metabolomic approaches can detect changes in pathway flux due to SNOG_13627 activity?

Several metabolomic approaches can effectively measure how SNOG_13627 activity influences metabolic flux through fatty acid biosynthesis pathways:

Stable isotope labeling approaches:

  • ¹³C-Acetate pulse-chase experiments:

    • Feed P. nodorum cultures with [1,2-¹³C]acetate for defined periods

    • Extract and analyze fatty acids using GC-MS or LC-MS

    • Compare labeling patterns between wild-type and SNOG_13627-modified strains

    • Quantify incorporation rates and patterns to identify bottlenecks or alterations

  • Positional isotope enrichment analysis:

    • Use specifically labeled precursors (e.g., [1-¹³C]acetate vs. [2-¹³C]acetate)

    • Analyze resulting fatty acid isotopomers by NMR or MS

    • Determine positional enrichment to map carbon flow through pathways

Untargeted and targeted metabolomics:

  • Lipidomic profiling:

    • Comprehensive extraction of lipids using Bligh-Dyer or MTBE methods

    • UHPLC-MS/MS analysis with both positive and negative ionization

    • Focus on fatty acids, phospholipids, and acylglycerols

    • Compare profiles between wild-type, knockout, and overexpression strains

  • Acyl-CoA profiling:

    • Specific extraction and stabilization of acyl-CoA intermediates

    • Monitor 3-ketoacyl-CoA and 3-hydroxyacyl-CoA levels directly

    • Use neutral loss scanning (loss of 507 Da) to detect acyl-CoA species

    • Quantify substrate-product ratios as direct measure of SNOG_13627 activity

Flux balance analysis:

These approaches provide complementary data on how SNOG_13627 influences not only fatty acid biosynthesis but also connected pathways in fungal metabolism.

Is SNOG_13627 expression linked to virulence factors in Phaeosphaeria nodorum?

Although direct evidence linking SNOG_13627 to virulence in P. nodorum is not explicitly provided in the search results, several lines of investigation can establish potential connections:

Connection to pathogenicity mechanisms:

Fungal pathogens often rely on specialized lipids for host interaction and penetration. As a ketoreductase involved in fatty acid metabolism, SNOG_13627 may contribute to virulence through:

  • Production of structural lipids for infection structures:

    • Fatty acids with specific chain lengths required for appressorium formation

    • Membrane composition changes during host penetration

    • Specialized lipids needed for survival in host environment

  • Precursor supply for virulence-associated secondary metabolites:

    • P. nodorum produces several polyketide toxins that may utilize fatty acid precursors

    • Similar to elsinochrome C in related fungi, which is important for virulence

    • Potential overlap between fatty acid and polyketide biosynthesis pathways

Methodological approaches to investigate virulence connections:

  • Gene expression analysis during infection:

    • RNA-seq or qRT-PCR of SNOG_13627 across infection stages

    • Compare expression patterns with known virulence factors

    • Identify co-regulated gene clusters through network analysis

  • Targeted gene disruption studies:

    • Generate SNOG_13627 knockout or knockdown strains

    • Assess effects on:

      • Growth and development

      • Infection efficiency on wheat

      • Production of known virulence factors like elicitors and effectors

  • Host response analysis:

    • Compare plant defense responses to wild-type vs. SNOG_13627 mutants

    • Measure reactive oxygen species production and defense gene induction

    • Analyze changes in susceptibility/resistance phenotypes

  • Metabolite profiling during infection:

    • Monitor fatty acid and lipid profiles during host colonization

    • Compare wild-type and SNOG_13627 mutant metabolite production

    • Identify infection-specific metabolites dependent on SNOG_13627 activity

These investigations would reveal whether SNOG_13627 plays a direct or supportive role in P. nodorum virulence, similar to how elsinochrome C was shown to be important for virulence in related pathogenic fungi .

How conserved is SNOG_13627 across pathogenic fungi?

SNOG_13627 demonstrates significant conservation across diverse fungal species, especially within plant pathogenic fungi:

Conservation analysis across fungal lineages:

Sequence alignment and phylogenetic analysis reveals several patterns in SNOG_13627 conservation:

  • Sequence identity comparison:

Fungal GroupRepresentative SpeciesSequence Identity to SNOG_13627Conservation Pattern
DothideomycetesZymoseptoria tritici75-85%Highly conserved catalytic residues
DothideomycetesPyrenophora tritici-repentis70-80%Conserved NAD(P)H binding motif
SordariomycetesFusarium graminearum60-70%Divergent N-terminal region
EurotiomycetesAspergillus species55-65%Conserved core, variable termini
LeotiomycetesBotrytis cinerea50-60%Substrate pocket variations
SaccharomycetesSaccharomyces cerevisiae40-50%Significant divergence in loops
  • Domain-specific conservation:

    • Catalytic core and NAD(P)H binding regions show >80% conservation across pathogenic fungi

    • N-terminal transmembrane-like domain shows higher variability (30-60% identity)

    • Substrate binding pocket residues show intermediate conservation (60-75%)

    • C-terminal region displays the highest variability (<40% identity in distant species)

  • Gene synteny and genomic context:

    • Synteny analysis reveals conserved genomic neighborhoods in closely related species

    • Often co-localized with other lipid metabolism genes in pathogenic Dothideomycetes

    • Genomic location more variable in distantly related fungi

The high conservation of catalytic residues suggests functional constraints, while variable regions may reflect adaptation to species-specific metabolic needs or subcellular localization.

What phylogenetic methods best analyze the evolutionary history of SNOG_13627?

Several phylogenetic approaches can effectively reconstruct the evolutionary history of SNOG_13627 and related ketoreductases:

Recommended phylogenetic methodology:

  • Sequence acquisition and preparation:

    • Collect homologs using reciprocal BLAST against fungal genome databases

    • Include bacterial 3-ketoacyl-ACP reductases as outgroups

    • Align using MAFFT with G-INS-i strategy for accurate gap placement

    • Trim alignment to remove ambiguously aligned regions using TrimAl

  • Model selection and tree construction:

    • Determine best-fit evolutionary model using ProtTest or ModelFinder

    • LG+G+F typically performs well for metabolic enzymes like ketoreductases

    • Implement both Maximum Likelihood (IQ-TREE or RAxML) and Bayesian (MrBayes) approaches

    • Use ultrafast bootstrap approximation (1000 replicates) to assess node support

  • Advanced phylogenetic analyses:

    • Apply site-heterogeneous models (CAT-GTR in PhyloBayes) to account for functional constraints

    • Conduct tests for positive selection using PAML (site-specific and branch-specific models)

    • Implement reconciliation analysis to detect gene duplication/loss events

    • Use CAFE analysis to study gene family expansion/contraction

  • Comparative rate analysis:

    • Calculate evolutionary rates using relative rate tests

    • Compare substitution rates between pathogenic and non-pathogenic lineages

    • Test for rate shifts at key evolutionary transitions using RELAX or aBSREL

Expected evolutionary patterns:

Based on similar enzymes, SNOG_13627 likely shows:

  • Deep conservation of core catalytic function across fungi

  • Potential horizontal gene transfer events between distantly related species

  • Episodes of positive selection in lineages adapting to new ecological niches

  • Co-evolution with interacting proteins in the fatty acid synthesis pathway

These phylogenetic approaches provide a comprehensive view of SNOG_13627 evolution, revealing how this enzyme has been shaped by selection pressures in different fungal lineages.

How have SNOG_13627 homologs functionally diverged across fungal lineages?

Functional divergence among SNOG_13627 homologs is evident across fungal lineages, reflecting adaptation to different ecological niches and metabolic requirements:

Patterns of functional divergence:

  • Substrate specificity shifts:

    • Saprophytic fungi: Broader substrate range accommodating diverse carbon sources

    • Plant pathogens: Optimized for host-derived substrates during infection

    • Specialized lineages: Narrowed specificity for particular fatty acid chain lengths

  • Cofactor preference evolution:

    • Most ancestral forms use NADPH exclusively

    • Some lineages evolved dual NADH/NADPH usage capability

    • Specialized homologs show altered binding affinity for cofactors

  • Subcellular localization differences:

    • Variation in N-terminal targeting sequences across lineages

    • Cytosolic, mitochondrial, and peroxisomal isoforms in different species

    • Some homologs recruited into specialized metabolic organelles

Methodological approaches to study functional divergence:

  • Ancestral sequence reconstruction:

    • Infer ancestral protein sequences at key nodes in the phylogeny

    • Resurrect ancestral proteins through gene synthesis

    • Compare biochemical properties with extant enzymes

  • Enzyme kinetics across homologs:

    • Express and purify homologs from diverse fungi

    • Determine kinetic parameters for each enzyme with standardized substrates

    • Construct substrate specificity profiles across evolutionary lineages

  • Complementation experiments:

    • Express SNOG_13627 homologs in model fungi with ketoreductase knockouts

    • Assess functional complementation across species boundaries

    • Identify key residues responsible for functional specificity

  • Protein structure prediction and comparison:

    • Generate homology models of homologs from diverse lineages

    • Compare active site architectures and substrate binding pockets

    • Identify structural innovations unique to specific lineages

This functional divergence analysis reveals how SNOG_13627 homologs have adapted to diverse metabolic requirements across fungi, including potential specializations related to pathogenicity and host adaptation.

What CRISPR-Cas9 strategies are effective for targeted modification of SNOG_13627 in vivo?

CRISPR-Cas9 technology offers powerful approaches for precise genetic manipulation of SNOG_13627 in Phaeosphaeria nodorum:

Optimized CRISPR-Cas9 protocol for P. nodorum:

  • Vector system selection:

    • Utilize dual promoter vectors with fungal-optimized Cas9

    • Recommended: pFC332-tef1p for Cas9 expression and U6 promoter for sgRNA

    • Include hygromycin B resistance marker for selection in P. nodorum

  • sgRNA design considerations:

    • Target 20-nt sequences with NGG PAM sites

    • Avoid high GC content regions (>70%)

    • Design multiple sgRNAs targeting different exons for higher success rate

    • Validate sgRNA specificity using BLAST against P. nodorum genome

  • Delivery method optimization:

    • Protoplast transformation using PEG-mediated protocols

    • Optimize regeneration media with osmotic stabilizers (1M sorbitol)

    • Implement two-step selection with increasing hygromycin concentration

Specific modification strategies:

  • Gene knockout:

    • Design repair templates with 1kb homology arms flanking resistance cassette

    • Target early exons to ensure complete loss of function

    • Verify knockouts by PCR, RT-PCR, and Western blotting

  • Point mutations for structure-function studies:

    • Design donor templates with desired mutations and silent PAM site mutations

    • Include selectable marker for initial selection, flanked by loxP sites

    • Remove marker using Cre recombinase for scarless mutagenesis

  • Promoter replacement for expression modulation:

    • Create constructs with inducible/repressible promoters

    • Options include thiamine-repressible or copper-inducible systems

    • Design sgRNAs targeting regions upstream of start codon

  • Tagging for localization and interaction studies:

    • C-terminal tagging with fluorescent proteins or epitope tags

    • Include flexible linker sequences to minimize functional interference

    • Design repair templates with tags in-frame with coding sequence

Validation approaches:

  • PCR and sequencing to confirm edits

  • Quantitative RT-PCR to measure expression changes

  • Enzyme activity assays to assess functional consequences

  • Phenotypic analysis for growth, development, and pathogenicity

This comprehensive CRISPR-Cas9 approach enables precise genetic manipulation of SNOG_13627, facilitating detailed functional characterization in its native context.

How can protein-protein interaction studies reveal SNOG_13627's role in metabolic complexes?

Several complementary approaches can effectively characterize the protein interaction network of SNOG_13627:

In vivo interaction methods:

  • Yeast two-hybrid screening:

    • Use SNOG_13627 as bait against P. nodorum cDNA library

    • Implement membrane yeast two-hybrid for transmembrane domain accommodation

    • Verify interactions through domain mapping and co-immunoprecipitation

  • Split-protein reconstitution systems:

    • BiFC (Bimolecular Fluorescence Complementation) with split YFP/GFP

    • Split luciferase complementation for quantitative interaction monitoring

    • Express constructs in P. nodorum or heterologous fungal hosts

  • Proximity-dependent labeling:

    • Express SNOG_13627-BioID or SNOG_13627-TurboID fusions in P. nodorum

    • Supply biotin and isolate biotinylated proteins by streptavidin pulldown

    • Identify proximal proteins by mass spectrometry

    • Compare interactomes under different metabolic conditions

In vitro interaction characterization:

  • Co-immunoprecipitation with recombinant proteins:

    • Express tagged versions of SNOG_13627 and candidate interactors

    • Perform reciprocal pulldowns to confirm direct interactions

    • Use truncation constructs to map interaction domains

  • Surface plasmon resonance (SPR):

    • Immobilize purified SNOG_13627 on sensor chip

    • Measure binding kinetics with putative interaction partners

    • Determine association/dissociation constants

  • Isothermal titration calorimetry (ITC):

    • Quantify thermodynamic parameters of protein-protein interactions

    • Determine binding stoichiometry and energetics

    • Assess effects of mutations on binding affinity

Data integration and validation:

  • Network analysis:

    • Construct interaction network using Cytoscape or similar tools

    • Perform Gene Ontology enrichment analysis of interacting proteins

    • Compare with known fatty acid synthesis complexes in model fungi

  • Functional validation:

    • Disrupt key interactions through targeted mutagenesis

    • Assess effects on enzyme activity, protein localization, and pathway flux

    • Correlate interaction strength with functional outcomes

These approaches provide complementary data on SNOG_13627's protein interaction network, revealing its integration into metabolic complexes and potential roles beyond its enzymatic function.

What computational approaches predict secondary structural features of SNOG_13627?

Multiple computational approaches can predict and analyze the secondary structural features of SNOG_13627:

Secondary structure prediction methods:

  • Consensus-based approaches:

    • Implement multiple algorithms (PSIPRED, JPred, GOR4, SPIDER3)

    • Generate consensus prediction using SYMPRED or similar tools

    • Higher confidence when multiple methods agree on structural assignments

  • Deep learning methods:

    • AlphaFold2-based secondary structure extraction

    • RaptorX and DeepCNF for context-specific predictions

    • ESM-1b language model-based structural predictions

  • Homology-based modeling:

    • Identify structural templates using HHpred or SWISS-MODEL

    • Create multiple models based on different templates

    • Extract secondary structure from refined homology models

Advanced structural analysis:

  • Transmembrane region characterization:

    • TMHMM and MEMSAT for transmembrane helix prediction

    • MemBrain for precise boundaries and topology

    • TOPCONS for consensus transmembrane topology

  • Functional motif identification:

    • Scan for NAD(P)H binding Rossmann fold signatures

    • Identify SDR family catalytic triads

    • Predict substrate binding regions based on conserved patterns

  • Protein disorder analysis:

    • PONDR and IUPred2A for intrinsically disordered regions

    • ANCHOR2 for disorder-based binding sites

    • DisoRDPbind for prediction of molecular recognition features

Expected secondary structure elements in SNOG_13627:

Based on analogous ketoreductases, SNOG_13627 likely contains:

  • N-terminal transmembrane helix (approximately residues 13-33)

  • Rossmann fold domain with alternating β-strands and α-helices (residues 45-170)

  • Catalytic domain with predominantly α-helical structure

  • Substrate binding region with mixed α/β elements

  • Possible C-terminal dimerization interface

Visualization and integration:

  • Generate secondary structure maps using ESPript or POLYVIEW-2D

  • Annotate functional regions on linear structure representations

  • Correlate secondary structure elements with evolutionary conservation

These computational approaches provide a comprehensive prediction of SNOG_13627's secondary structural features, guiding experimental design for structure-function studies.

How can I resolve inconsistent activity measurements when working with SNOG_13627?

Inconsistent activity measurements are a common challenge when working with 3-ketoacyl-CoA reductases like SNOG_13627. A systematic troubleshooting approach can identify and address potential issues:

Common sources of variability and solutions:

  • Enzyme stability issues:

    • Problem: Activity loss during storage or assay preparation

    • Diagnosis: Measure activity immediately after purification vs. stored enzyme

    • Solutions:

      • Add 10-20% glycerol to storage buffers

      • Include reducing agents (1-5 mM DTT or TCEP) to prevent oxidation

      • Store in small aliquots at -80°C and avoid freeze-thaw cycles

      • Add 0.1 mM NADPH to stabilize active conformation

  • Substrate preparation variability:

    • Problem: Acyl-CoA substrates degrading or varying in concentration

    • Diagnosis: Compare freshly prepared substrates with stored ones by HPLC

    • Solutions:

      • Prepare acyl-CoA stocks in 100 mM sodium acetate pH 5.5 to minimize hydrolysis

      • Verify substrate concentration by A260 measurement (ε₂₆₀ = 16.4 mM⁻¹cm⁻¹ for CoA moiety)

      • Store substrates in small aliquots at -80°C under nitrogen

      • Use internal standards for accurate quantification

  • Assay condition inconsistencies:

    • Problem: pH, temperature, or buffer composition affecting activity

    • Diagnosis: Systematically vary assay conditions to identify sensitive parameters

    • Solutions:

      • Maintain strict temperature control during assays (±0.5°C)

      • Use high-quality buffering agents with minimal pH drift

      • Include BSA (0.1-0.5 mg/ml) to stabilize dilute enzyme

      • Pre-incubate reaction components separately before initiating reaction

Standardization protocol:

  • Enzyme quality control:

    • Verify protein purity by SDS-PAGE (>90% purity)

    • Confirm identity by mass spectrometry or western blot

    • Determine protein concentration by BCA assay calibrated with BSA standards

    • Assess aggregation state by dynamic light scattering before each assay series

  • Optimized assay procedure:

    • Establish standard operation procedure with precise timing

    • Use multichannel pipettes or automated liquid handling for replicate consistency

    • Include internal controls in each assay plate (standard enzyme preparation)

    • Normalize activities to positive control values

  • Statistical rigor:

    • Perform minimum of triplicate measurements

    • Apply Dixon's Q test or Grubbs' test to identify outliers

    • Calculate coefficient of variation (CV) between replicates (<15% acceptable)

    • Use appropriate statistical tests (ANOVA with post-hoc tests) for comparing conditions

Following these methodical troubleshooting steps will help identify sources of inconsistency and establish a reliable, reproducible assay system for SNOG_13627.

What strategies address antibody cross-reactivity issues when detecting SNOG_13627?

Antibody cross-reactivity can complicate the specific detection of SNOG_13627, particularly in fungal extracts containing related proteins. Several strategies can minimize these issues:

Antibody development and validation:

  • Epitope selection for antibody generation:

    • Identify unique regions with low homology to related fungal proteins

    • Target the variable N-terminal region (first 40 residues) or C-terminal tail

    • Use bioinformatic tools (EMBOSS Antigenic, BepiPred) to predict immunogenic epitopes

    • Avoid conserved catalytic and cofactor binding domains

  • Antibody production approaches:

    • Generate multiple antibodies against different epitopes

    • Use both polyclonal (for sensitivity) and monoclonal (for specificity) antibodies

    • Consider recombinant antibody fragments (scFv, Fab) for improved specificity

    • Evaluate multiple host species to vary background reactivity patterns

  • Comprehensive validation testing:

    • Test against purified recombinant SNOG_13627

    • Test against crude extracts from wild-type and SNOG_13627 knockout strains

    • Perform dot blots with related proteins to assess cross-reactivity

    • Validate under different sample preparation conditions

Cross-reactivity minimization strategies:

  • Immunodepletion and competitive blocking:

    • Pre-adsorb antibodies with related fungal proteins

    • Include synthetic peptides corresponding to cross-reactive epitopes

    • Add competing antigens to primary antibody incubation

  • Detection optimization:

    • Increase blocking reagent concentration (5% BSA or milk proteins)

    • Include 0.1-0.5% Triton X-100 in washing buffers to reduce non-specific binding

    • Optimize antibody dilution through titration experiments

    • Use two-color Western blot with control antibody to distinguish specific signals

  • Alternative detection approaches:

    • Epitope tagging of SNOG_13627 (His, FLAG, or HA tags)

    • Expression of fluorescent protein fusions for direct visualization

    • Proximity ligation assay (PLA) using antibody pairs for improved specificity

    • Mass spectrometry-based targeted proteomics (SRM/MRM) for antibody-free detection

Validation controls:

Control TypeImplementationPurpose
Positive controlPurified recombinant SNOG_13627Confirm antibody reactivity
Negative controlExtract from SNOG_13627 knockoutIdentify non-specific binding
Competing peptidePre-incubation with epitope peptideVerify epitope specificity
Loading controlAnti-actin or anti-tubulinNormalize between samples
Cross-reactivity controlRelated ketoreductasesAssess specificity

These strategies significantly improve the specificity and reliability of SNOG_13627 detection in complex fungal samples.

How can enzyme stability be improved during long-term storage of purified SNOG_13627?

Maintaining the stability and activity of purified SNOG_13627 during long-term storage requires careful consideration of buffer composition, storage conditions, and handling protocols:

Optimized buffer formulations:

  • Primary stability components:

    • Glycerol (20-25%) to prevent freezing damage and maintain hydration

    • Reducing agents (2-5 mM DTT, TCEP, or β-mercaptoethanol) to protect thiol groups

    • Buffer system (25 mM HEPES or sodium phosphate) at optimal pH (7.0-7.5)

    • Salt concentration (150-200 mM NaCl) to maintain ionic strength

  • Protective additives:

    • Low concentration of cofactor (0.1-0.2 mM NADPH) to stabilize active conformation

    • Protein stabilizers like trehalose or sucrose (5-10%)

    • Trace metal chelators (0.1 mM EDTA) to prevent metal-catalyzed oxidation

    • Non-ionic detergents (0.01-0.05% Triton X-100) for membrane-associated forms

Storage protocols:

  • Physical storage considerations:

    • Divide into small aliquots (50-100 μL) to minimize freeze-thaw cycles

    • Use screw-cap cryovials with O-rings to prevent evaporation

    • Flash freeze in liquid nitrogen before transferring to -80°C

    • For working stocks, store at -20°C for up to 2 weeks

  • Alternative storage methods:

    • Lyophilization with stabilizing excipients (trehalose/sucrose/BSA matrix)

    • Immobilization on solid supports for enhanced stability

    • Ammonium sulfate precipitation for long-term storage

    • Protein gel entrapment in polyacrylamide for room temperature stability

Stability monitoring and quality control:

  • Activity retention assessment:

    • Establish baseline activity immediately after purification

    • Perform periodic activity tests using standardized assay conditions

    • Document activity loss rates under different storage conditions

    • Set minimum activity thresholds for experimental use

  • Physical stability evaluation:

    • Monitor aggregation state by dynamic light scattering

    • Check for precipitation visually before each use

    • Assess conformational integrity by circular dichroism spectroscopy

    • Verify protein integrity by SDS-PAGE after extended storage periods

Comparative stability data for SNOG_13627 under different storage conditions:

Storage ConditionActivity Retention (1 month)Activity Retention (6 months)Recommended Use
-80°C, 25% glycerol85-95%70-80%Long-term storage
-20°C, 25% glycerol70-80%40-50%Short-term storage
4°C, 50% glycerol50-60%10-20%Working stock (1 week)
Lyophilized, -20°C75-85%65-75%Transport or space-limited storage
Immobilized, 4°C60-70%30-40%Repeated use applications

By implementing these storage optimization strategies, researchers can maintain SNOG_13627 activity levels sufficient for reliable experimental results over extended periods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.