Recombinant Phaeosphaeria nodorum Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Description

Overview of Phaeosphaeria nodorum

Phaeosphaeria nodorum is a fungal pathogen known for causing Septoria nodorum blotch (SNB) in wheat, a disease that leads to significant yield losses . Early genomic investigations into P. nodorum revealed 48 biosynthetic gene clusters . Phylogenetic and population genetic analyses suggest that P. nodorum, along with its close relatives, may have originated in the Fertile Crescent and include cryptic species .

AIM31 and Mitochondrial Function

AIM31 refers to Altered Inheritance of Mitochondria protein 31, found within mitochondria. Research indicates that a related protein, Aim32, is a dual-localized 2Fe-2S mitochondrial protein involved in redox quality control . Mitochondria-targeted molecules, such as SS31, have shown promise in reducing mitochondrial toxicity and synaptic damage in diseases like Alzheimer's and Huntington's disease .

SS31 is a mitochondria-targeted tetra-peptide that has shown protective effects against amyloid-beta (Aβ)-induced mitochondrial and synaptic toxicities relevant to Alzheimer’s disease (AD) . Studies involving the administration of SS31 to an AD mouse model (APP) revealed that SS31 crosses the blood-brain barrier and reaches mitochondrial sites, reducing Aβ production, mitochondrial dysfunction, and maintaining mitochondrial dynamics, while enhancing mitochondrial biogenesis and synaptic activity .

SS31 Effects on Mitochondrial Dynamics and Biogenesis

Experiments have demonstrated that SS31 can influence mitochondrial dynamics and biogenesis. In Aβ-treated neuroblastoma cells, SS31 treatment increased the expression of mitochondrial fusion genes, decreased $$H_2O_2$$ production, and increased cytochrome oxidase activity (COX) and ATP levels, suggesting that SS31 reduces mitochondrial dysfunction and oxidative stress .

Table 1: mRNA Levels in SS31-Treated and Untreated APP Mice

GenesmRNA fold changes
APP-SS31
Mitochondrial structural genes
Drp1-2.7**
Fis1-2.4*
Mfn13.0**
Mfn22.2*
OPA12.1*
Synaptic genes
Synaptophysin2.2**
PSD955.1**
Biogenesis genes
PGC1α3.0**
Nrf13.4**
Nrf22.1*
TFAM2.5**

* P<0.05; ** P<0.005

Tox1 Regulation in P. nodorum

The regulation of the Tox1 gene in P. nodorum is influenced by genetic variability in the promoter region, which drives differential Tox1 expression and affects epistasis . A polymorphic NE regulatory element, PE401, located upstream of the start codon of Tox1, represses Tox1 expression, likely targeted by sequence-specific repressor proteins .

Tox1 Repression by PE401

Quantitative RT-PCR analysis has shown that the presence of PE401 leads to a significant reduction in Tox1 gene expression . P. nodorum isolates lacking PE401 are more pathogenic on Snn1 wheat varieties compared to those carrying PE401 .

QTL Analysis

QTL analysis revealed that Tox1 repression by PE401 alleviates the epistatic effect on Tox2A-Qsnb.cur–2AS1 but not Tox3-Snn3B1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RCF1; AIM31; SNOG_01023; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
RCF1
Target Protein Sequence
MAGMGPPNSAPLPSSFDENADFYNENTIDKIWRRFREEPLIPFGCGLTAWAIVGASRSMR KGDHKMTNLYFRRRLYAQSFTIAVLVIGNLYWQKDRVKRKDYERMKAETERKEKRDRWLR ELEMRDEEDKAWKERLAKKTRGAADEAKGVTDMVAEKTKELKDQTLGK
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does AIM31 relate to other mitochondrial proteins in fungi?

AIM31 works cooperatively with other mitochondrial proteins, particularly in respiratory chain organization. In yeast, Rcf1 (AIM31) shares an overlapping function with Rcf2 (formerly Aim38), and both proteins can independently bind to the cytochrome bc1-COX supercomplex . The loss of both proteins significantly impacts:

  • COX enzyme activity

  • Assembly of peripheral COX subunits (Cox12 and Cox13)

  • Formation of respiratory supercomplexes

Based on sequence comparisons, P. nodorum AIM31 shares significant homology with Hig1 family proteins from other fungi, with conserved functional domains including:

DomainPositionFunction
TransmembraneN-terminalMembrane anchoring
Hig1 conserved motifCentralInteraction with respiratory complexes
C-terminal regionC-terminalSpecies-specific adaptations

What are the recommended methodologies for studying AIM31 function in P. nodorum?

Several complementary approaches can be employed:

Gene Deletion and Complementation

  • Generate knockout mutants using fusion PCR techniques:

    • Amplify 5' and 3' UTR fragments flanking AIM31

    • Fuse these to an antibiotic resistance cassette (e.g., phleomycin)

    • Transform P. nodorum through PEG-mediated transformation

    • Verify gene deletion using PCR and quantitative PCR for copy number

  • Create complementation strains by reintroducing the native gene with its promoter and terminator regions to confirm phenotypes are directly attributable to AIM31 .

Protein Localization and Interaction Studies

  • Express tagged versions of AIM31 (fluorescent or epitope tags)

  • Use Blue Native PAGE (BN-PAGE) to analyze intact respiratory complexes containing AIM31

  • Perform affinity purification using histidine-tagged derivatives to isolate intact complexes

  • Use mass spectrometry to identify interaction partners

Functional Assays

  • Measure cytochrome c oxidase activity in wild-type vs. mutant strains

  • Analyze growth under different carbon sources and oxygen conditions

  • Assess mitochondrial membrane potential and respiration rates

How might AIM31 contribute to P. nodorum virulence in wheat infections?

While direct evidence linking AIM31 to pathogenicity is limited, several mechanisms can be hypothesized:

  • Energy production for infection processes: As a component of the respiratory chain, AIM31 likely influences energy metabolism critical for host penetration, colonization, and reproduction. P. nodorum exhibits regular recombination, high levels of gene flow, and high effective population sizes, suggesting robust metabolic adaptability .

  • Adaptation to host microenvironments: Being part of the hypoxia-induced gene family, AIM31 may help P. nodorum adapt to oxygen-limited conditions encountered during wheat infection.

  • Indirect effects on effector production: Mitochondrial function affects cellular metabolism, which could influence biosynthesis of virulence factors. P. nodorum produces multiple host-selective toxins (HSTs) including SnToxA, SnTox1, and SnTox3, which are critical virulence factors .

  • Stress resistance: Proper respiratory chain function contributes to stress tolerance, including resistance to host-derived reactive oxygen species.

To test these hypotheses, researchers should:

  • Compare infection phenotypes between wild-type and AIM31 knockout strains on different wheat varieties

  • Measure toxin production in AIM31 mutants

  • Analyze transcriptome changes in respiratory pathways during infection

What is the relationship between AIM31 and secondary metabolite production in P. nodorum?

P. nodorum harbors a large number of secondary metabolite genes that may play important roles in its virulence . The relationship between AIM31 and secondary metabolism can be explored through:

Experimental Approaches:

  • Metabolite Profiling:

    • Compare metabolite profiles of wild-type and AIM31 mutant strains using LC-MS/MS

    • Focus on known P. nodorum metabolites such as alternariol, phomenoic acid, and melanin

  • Biosynthetic Gene Expression Analysis:

    • Measure expression of key secondary metabolite genes in AIM31 mutants, including:

      • Polyketide synthases (PKS) genes like SNOG_15829 (alternariol biosynthesis candidate)

      • Non-ribosomal peptide synthetases (NRPS)

      • Terpene synthases

  • Mitochondrial-Secondary Metabolism Connection:

    • Analyze precursor availability from primary metabolism in AIM31 mutants

    • Measure ATP levels and redox balance as indicators of metabolic capacity

Known Secondary Metabolites in P. nodorum:

Metabolite ClassRepresentative CompoundsBiosynthetic GenesPossible AIM31 Influence
PolyketidesAlternariolSNOG_15829Energy provision for biosynthesis
MelaninDHN-melanin, L-DOPA melaninSNOG_08274, SNOG_09932Redox balance for precursors
TerpenesUncharacterizedSNOG_09915Precursor supply (acetyl-CoA)

The genome of P. nodorum contains 23 putative secondary metabolite gene clusters, suggesting a rich capacity for small molecule production .

How does genetic diversity in wheat hosts affect P. nodorum AIM31 evolution?

Research has shown that increasing genetic heterogeneity in host populations may retard the rate of evolution in associated pathogen populations . For AIM31, this relationship could be investigated by:

  • Comparative genomics of AIM31 sequences from P. nodorum isolates collected from monoculture versus multi-cultivar fields

  • Selection coefficient analysis to determine if AIM31 is under different selection pressures depending on host diversity

  • Expression studies to examine if AIM31 transcription differs when P. nodorum infects resistant versus susceptible wheat varieties

What are the most effective expression systems for producing recombinant P. nodorum AIM31?

Multiple expression systems can be employed, each with advantages:

coli Expression System

  • Vector options: pET series vectors with N- or C-terminal tags

  • Strain recommendations: BL21(DE3), Rosetta, or C41/C43 for membrane proteins

  • Optimization strategies:

    • Low temperature induction (16-18°C)

    • Codon optimization for E. coli

    • Fusion partners (MBP, SUMO) to enhance solubility

  • Purification approach: IMAC purification via histidine tag, followed by size exclusion chromatography

Yeast Expression System

  • Advantages: Eukaryotic protein processing, suitable for mitochondrial proteins

  • Recommended hosts: Saccharomyces cerevisiae or Pichia pastoris

  • Vectors: pYES2 (S. cerevisiae) or pPICZ (P. pastoris)

  • Purification approach: Similar to E. coli but with optimized cell lysis for yeast

Baculovirus and Mammalian Systems

For applications requiring higher-order eukaryotic processing:

  • Baculovirus expression in insect cells offers good yield with eukaryotic modifications

  • Mammalian cell expression provides the most authentic post-translational modifications

Production of biotinylated AIM31 using Avi-tag systems can be valuable for interaction studies, as demonstrated by similar approaches with other proteins .

How might AIM31 influence production or activity of P. nodorum effectors?

P. nodorum produces multiple host-selective toxins that function as effectors in the wheat interaction. While direct evidence linking AIM31 to effector regulation is lacking, mitochondrial function could influence effector production through:

  • Energy provision for biosynthesis: Secondary metabolism, including toxin production, requires substantial energy input that depends on mitochondrial function

  • Regulatory connections: In P. nodorum, effector genes like SnToxA and SnTox3 are regulated by transcription factors such as PnPf2 . Investigation of potential links between mitochondrial status and transcription factor activity would be valuable.

  • Metabolic precursors: Mitochondria provide precursors for various cellular processes including secondary metabolism.

Experimental approaches:

  • Measure effector gene expression (SnToxA, SnTox3, SnTox1) in AIM31 mutants

  • Analyze culture filtrates from mutants for effector activity on differential wheat lines

  • Investigate whether mitochondrial stress affects effector production

  • Determine if AIM31 disruption alters the epistatic relationships between effectors (e.g., SnTox1-SnTox3 epistasis)

How does P. nodorum AIM31 compare to homologs in other fungal pathogens?

Comparative analysis of AIM31 across fungal species provides evolutionary insights:

Sequence and Functional Conservation:

  • AIM31/Rcf1 displays high conservation among fungi, particularly within the Pleosporales order

  • The yeast Rcf1 protein shares significant similarity with fungal Hig1 family members

  • P. nodorum and related species within Parastagonospora show expected evolutionary relationships at the genome level that likely extend to AIM31

Experimental Approaches for Comparative Studies:

  • Complementation experiments:

    • Express P. nodorum AIM31 in yeast rcf1Δ mutants to test functional conservation

    • Compare phenotypic rescue efficiency across AIM31 homologs from different fungi

  • Domain swap experiments:

    • Create chimeric proteins with domains from different fungal species

    • Identify which regions confer species-specific functions

  • Structural biology:

    • Generate homology models based on experimental structures

    • Identify conserved and variable regions that may reflect functional adaptation

How does AIM31 contribute to P. nodorum adaptation to different environmental conditions?

P. nodorum must adapt to various environments during its life cycle, including saprophytic growth on plant debris and pathogenic growth in wheat tissue. AIM31 may contribute to this adaptability through:

  • Oxygen response: As part of the hypoxia-induced gene family, AIM31 likely helps P. nodorum adapt to varying oxygen levels encountered during wheat colonization.

  • Metabolic flexibility: Studies in wheat fields have shown P. nodorum exhibiting both pathogenic and saprophytic phases , suggesting metabolic adaptability potentially involving mitochondrial function.

  • Temperature adaptation: Respiratory chain composition can affect temperature tolerance, which is important as P. nodorum experiences seasonal temperature variations.

Research approaches:

  • Compare growth and mitochondrial function of wild-type and AIM31 mutants under varying oxygen levels, carbon sources, and temperatures

  • Analyze AIM31 expression patterns during the transition from saprophytic to pathogenic growth

  • Investigate the correlation between AIM31 sequence variants and environmental adaptation in different geographical isolates

P. nodorum populations show evidence of regular recombination and high gene flow , suggesting ongoing adaptation to various environmental conditions that may involve mitochondrial function optimization.

What are the most promising avenues for future research on P. nodorum AIM31?

Several high-priority research directions emerge:

  • AIM31 knockout studies in P. nodorum:

    • Create and characterize AIM31 deletion mutants

    • Analyze effects on growth, development, and pathogenicity

    • Examine mitochondrial function and supercomplex assembly

  • Regulatory network identification:

    • Determine factors controlling AIM31 expression during different lifecycle stages

    • Investigate how environmental signals modulate AIM31 function

  • Protein-protein interaction mapping:

    • Identify P. nodorum proteins interacting with AIM31

    • Compare with interaction networks in model systems like yeast

    • Determine unique interactions related to pathogenicity

  • Omics-based approaches:

    • Conduct transcriptomics, proteomics, and metabolomics on AIM31 mutants

    • Develop integrated network models of how mitochondrial function influences pathogenicity

    • Compare patterns across multiple Parastagonospora species with varying host ranges

  • Evolutionary analysis:

    • Examine AIM31 sequence conservation across the Parastagonospora genus

    • Correlate sequence variations with host range and environmental adaptations

    • Investigate evidence of selection on AIM31 in agricultural versus natural ecosystems

These research directions would significantly advance our understanding of how fundamental mitochondrial functions contribute to fungal pathogenicity and adaptation in this economically important wheat pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.