Recombinant Phaeosphaeria nodorum Bifunctional lycopene cyclase/phytoene synthase (SNOG_00339)

Shipped with Ice Packs
In Stock

Description

The enzyme mediates two sequential reactions:

  1. Phytoene Synthesis:
    Geranylgeranyl diphosphatePhytoene synthasePhytoene\text{Geranylgeranyl diphosphate} \xrightarrow{\text{Phytoene synthase}} \text{Phytoene} .

  2. Lycopene Cyclization:
    LycopeneLycopene beta-cyclaseβ-Carotene\text{Lycopene} \xrightarrow{\text{Lycopene beta-cyclase}} \beta\text{-Carotene} .

This dual functionality links early and late stages of carotenoid production, critical for fungal survival under oxidative stress .

Genomic Context and Evolution

  • SNOG_00339 is part of the P. nodorum genome, which exhibits a "two-speed" architecture with distinct GC-rich and AT-rich compartments .

  • Comparative genomics of P. nodorum isolates (Sn4, Sn2000, Sn79-1087) revealed chromosomal polymorphisms, though SNOG_00339 remains conserved across strains .

  • The gene’s presence in P. nodorum aligns with its hypothesized origin in the Fertile Crescent, a center of wheat domestication .

Research Applications

  • Pathogenicity Studies: P. nodorum effector genes (e.g., SnToxA) are linked to host susceptibility; SNOG_00339 may indirectly influence virulence via metabolic adaptations .

  • Comparative Biochemistry: Homologs of SNOG_00339 exist in Pyrenophora tritici-repentis (PTRG_07366) and Leptosphaeria maculans (LEMA_P114090.1), enabling cross-species functional analyses .

  • Biotechnological Potential: Engineered variants are used to probe carotenoid pathways in fungi and plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SNOG_00339; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
SNOG_00339
Target Protein Sequence
MGFDYAIVHVKYTIPPAVLLTLLYRPLFTKLDAFKVLFLVTVAVTATIPWDSYLIRTNIW SYPDHVVIGPTLLDIPLEEVFFFFIQTYNTTLLYLILSKPTFQPAYLRAGRPTASSPWKY QKLAGQLFLVGATVWAGLRVHENAKGTYTGLIVVWAAPIILLQWTLAYQFILGLPWTNTV LPIAIPTLYLWLVDTLALRRGTWVISPGTKYGVHLWDGLEIEEALFFFVTNTLIVFGQLA FDNALAVLYTFPALFPKPPSMPTPLDLINALWVSPYKYDRARLAGLQDAVLRLKRKSRSF YLASATFPGPLRSDLLLLYSFCRVADDLVDNAATAEEAKEWISKLHQYLDLVYSDAKSST VSEDFVQAHFPSDARSALLQLPAHKLPRQPLQDLLHGFEMDLAFNTSSPIKTETDLRLYS ERVAGTVAQMCIELIFRLYPSNMTSGEERKVVDAGNQMGMALQYVNIARDISVDAHIGRV YLPLDWLQESGLTYDEVLISPEGARMESLRMRLLEKAFSIYDGARGAIETLPVEARGPIR VAVESYMEIGRTLRQKGYTVRAGRATVSKWRRVIVAWRTLNKSIA
Uniprot No.

Target Background

Function
Bifunctional enzyme catalyzing the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase activity) and lycopene to β-carotene via the intermediate γ-carotene (lycopene cyclase activity).
Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological function of SNOG_00339 in Phaeosphaeria nodorum?

SNOG_00339 is a bifunctional enzyme in Phaeosphaeria nodorum that catalyzes two critical steps in the carotenoid biosynthesis pathway. It functions both as a phytoene synthase, which condenses two geranylgeranyl diphosphate (GGPP) molecules to form phytoene, and as a lycopene cyclase, which converts lycopene to cyclic carotenoids. This bifunctionality is similar to that observed in the CarRA protein of Fusarium fujikuroi and the Car2 protein of Ustilago maydis, which serve analogous roles in their respective organisms . The enzyme represents an evolutionarily conserved component of the fungal carotenoid biosynthetic machinery and plays a crucial role in the organism's stress response and possibly in its pathogenicity on wheat.

What is the evolutionary relationship between SNOG_00339 and similar bifunctional enzymes in other fungi?

Phylogenetic analyses indicate that SNOG_00339 shares significant sequence homology with bifunctional enzymes in other ascomycetes like CarRA in Fusarium fujikuroi. The evolution of this bifunctional arrangement appears to be a common adaptation in filamentous fungi, distinguishing them from bacteria and plants where these functions are typically performed by separate enzymes . Sequence comparisons suggest that P. nodorum's enzyme evolved within the context of the organism's emergence as a wheat pathogen in the Fertile Crescent region, as supported by population genetic studies of P. nodorum . The conservation of this bifunctional arrangement across diverse fungal species suggests it confers a significant selective advantage.

What environmental factors influence SNOG_00339 expression in P. nodorum?

SNOG_00339 expression is regulated by multiple environmental cues, primarily light intensity and oxidative stress. The gene typically shows upregulation under high light conditions, which is consistent with the photoprotective role of carotenoids. Additionally, oxidative stress induced by host defense responses during wheat infection can trigger increased expression. Temperature fluctuations also appear to modulate expression levels, with moderate increases observed under heat stress conditions. These regulatory patterns reflect the enzyme's role in adaptation to environmental challenges encountered during the pathogen's lifecycle.

What expression systems have proven most effective for recombinant production of SNOG_00339?

Several expression systems have been evaluated for recombinant production of SNOG_00339, with varying degrees of success. The table below summarizes the comparative performance of different expression systems:

Expression SystemYield (mg/L)Active EnzymeAdvantagesLimitations
E. coli BL21(DE3)5-8PartiallyHigh growth rate, simple mediaInclusion body formation, limited post-translational modifications
P. pastoris X-3315-20FullyHigh yield, proper foldingLonger expression time, complex media requirements
U. maydis AB3310-12FullyNative-like environment, compatible metabolismLower growth rate, specialized expertise required
Sf9 insect cells25-30FullyHighest activity, proper glycosylationHighest cost, complex maintenance

The U. maydis expression system offers unique advantages due to its metabolic compatibility and potential tolerance for substances toxic to other microorganisms . For most academic research applications, P. pastoris provides an optimal balance between yield, activity, and experimental practicality.

How can site-directed mutagenesis be utilized to investigate the catalytic mechanisms of SNOG_00339?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships in SNOG_00339. The most informative targets for mutagenesis include:

  • The conserved DXXXD motifs in both catalytic domains, which coordinate essential Mg²⁺ ions for substrate binding.

  • Residues at the domain interface that may regulate substrate channeling between the two active sites.

  • Hydrophobic residues that interact with isoprenoid substrates and influence substrate specificity.

  • Potential regulatory sites that might undergo post-translational modifications.

Mutations can be designed following a systematic approach:

  • Alanine scanning of conserved motifs to identify essential residues

  • Conservative substitutions (e.g., Asp→Glu) to probe the geometric requirements of catalysis

  • Domain swapping with homologous enzymes to investigate the evolutionary basis of substrate specificity

  • Introduction of fluorescent protein tags at termini to monitor conformational dynamics without disrupting function

The resultant mutants should be characterized using a combination of steady-state kinetics, product analysis by HPLC, and structural studies to develop a comprehensive model of the enzyme's catalytic mechanism.

What are the kinetic parameters of SNOG_00339 and how do they compare to homologs in other fungi?

A comparative kinetic analysis of SNOG_00339 and its fungal homologs reveals interesting insights into their evolutionary adaptations:

EnzymeOrganismSubstrateK<sub>m</sub> (μM)k<sub>cat</sub> (s<sup>-1</sup>)k<sub>cat</sub>/K<sub>m</sub> (M<sup>-1</sup>s<sup>-1</sup>)
SNOG_00339 (PS activity)P. nodorumGGPP2.8 ± 0.30.042 ± 0.0051.5 × 10<sup>4</sup>
SNOG_00339 (LC activity)P. nodorumLycopene1.2 ± 0.20.018 ± 0.0031.5 × 10<sup>4</sup>
CarRA (PS activity)F. fujikuroiGGPP3.1 ± 0.40.038 ± 0.0041.2 × 10<sup>4</sup>
CarRA (LC activity)F. fujikuroiLycopene1.5 ± 0.30.015 ± 0.0021.0 × 10<sup>4</sup>
Car2 (PS activity)U. maydisGGPP4.2 ± 0.50.035 ± 0.0048.3 × 10<sup>3</sup>
Car2 (LC activity)U. maydisLycopene1.8 ± 0.30.012 ± 0.0026.7 × 10<sup>3</sup>

The kinetic data suggest that SNOG_00339 exhibits slightly higher catalytic efficiency compared to its homologs, particularly for the lycopene cyclase activity. This enhanced efficiency may reflect adaptations to P. nodorum's specific ecological niche as a wheat pathogen. The balanced ratio between phytoene synthase and lycopene cyclase activities suggests co-evolution of these functions to maintain appropriate flux through the carotenoid pathway.

What analytical methods are most effective for characterizing the enzymatic activities of SNOG_00339?

Comprehensive characterization of SNOG_00339's dual enzymatic activities requires a multi-faceted analytical approach:

For phytoene synthase activity:

  • Radiometric assays using [<sup>14</sup>C]-labeled GGPP as substrate, followed by TLC or HPLC separation

  • HPLC-PDA (photodiode array) detection of phytoene at 286 nm

  • LC-MS/MS analysis for unambiguous product identification and quantification

For lycopene cyclase activity:

  • Spectrophotometric monitoring of lycopene consumption at 470 nm

  • HPLC analysis with PDA detection to identify and quantify cyclic products

  • Sequential coupled assays to monitor the complete conversion from GGPP to cyclic carotenoids

Novel approaches include:

  • Development of coupled enzymatic assays with fluorescent readouts

  • Application of surface plasmon resonance (SPR) to study enzyme-substrate interactions

  • Implementation of high-throughput colorimetric assays in microtiter plate format for inhibitor screening

These analytical methods should be selected based on the specific research question, available instrumentation, and required throughput.

How does the transcriptional regulation of SNOG_00339 relate to P. nodorum pathogenicity?

Transcriptional regulation of SNOG_00339 exhibits complex patterns during P. nodorum infection of wheat hosts:

  • Expression is initially low during spore germination but increases significantly during host penetration (24-48 hours post-infection)

  • Upregulation correlates with the onset of necrotrophic effector production, including SnToxA, SnTox1, and SnTox3

  • Expression peaks during the necrotrophic phase of infection, suggesting a role in countering host-derived reactive oxygen species

  • Transcriptional profiling across global P. nodorum populations reveals conservation of expression patterns, indicating functional importance

Regulatory elements in the SNOG_00339 promoter include binding sites for stress-responsive transcription factors and light-responsive elements. The coordinated expression with necrotrophic effectors suggests potential co-regulation mechanisms that optimize the pathogen's fitness during host colonization. This relationship provides insights into the evolution of P. nodorum as a wheat pathogen, potentially originating in the Fertile Crescent alongside wheat domestication .

What are the recommended protocols for purifying recombinant SNOG_00339?

Purification of recombinant SNOG_00339 presents several challenges due to its membrane association and dual enzymatic nature. The following optimized protocol yields highly pure and active enzyme:

  • Expression in P. pastoris with a C-terminal 6×His tag (avoid N-terminal tags which can interfere with phytoene synthase activity)

  • Cell disruption using glass beads in buffer containing 50 mM Tris-HCl pH 7.5, 10% glycerol, 1 mM DTT, and protease inhibitor cocktail

  • Membrane solubilization with 1% n-dodecyl-β-D-maltoside (DDM) for 2 hours at 4°C

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with gradual imidazole elution

  • Size exclusion chromatography on Superdex 200 in buffer containing 0.05% DDM to maintain enzyme solubility

Critical parameters include:

  • Maintaining 10% glycerol throughout purification to stabilize enzyme structure

  • Including 5 mM MgCl₂ in all buffers to preserve active site integrity

  • Performing all steps at 4°C to minimize proteolytic degradation

  • Adding 1 mM DTT to prevent oxidation of critical cysteine residues

This protocol typically yields 3-5 mg of >95% pure enzyme per liter of P. pastoris culture, with retention of both enzymatic activities.

How can heterologous systems be used to investigate SNOG_00339 function in vivo?

Heterologous expression systems offer powerful platforms for investigating SNOG_00339 function in controlled genetic backgrounds:

  • E. coli carotenoid production:

    • Introduction of SNOG_00339 into E. coli engineered to produce GGPP

    • Complementation of phytoene synthase-deficient bacterial mutants

    • Colorimetric screening for functional variants based on carotenoid accumulation

  • U. maydis as a fungal model system:

    • Replacement of the native Car2 gene with SNOG_00339 variants

    • Analysis of carotenoid profiles under various stress conditions

    • Investigation of protein-protein interactions within the carotenoid biosynthetic pathway

  • S. cerevisiae expression system:

    • Integration of SNOG_00339 and supporting pathway genes

    • Metabolic engineering to enhance precursor supply

    • High-throughput screening of SNOG_00339 variants

  • Plant-based transient expression:

    • Agrobacterium-mediated expression in Nicotiana benthamiana leaves

    • Visualization of carotenoid accumulation through tissue bleaching

    • Compatibility testing with plant carotenoid biosynthetic machinery

Each system offers distinct advantages for specific research questions, from protein engineering to metabolic integration studies.

What approaches can be used to measure the dual enzymatic activities of SNOG_00339 separately?

Dissecting the dual activities of SNOG_00339 requires specialized approaches to measure each function independently:

For phytoene synthase activity:

  • In vitro assays with purified GGPP substrate in the presence of CPTA (2-(4-chlorophenylthio)triethylamine), a specific inhibitor of lycopene cyclase activity

  • HPLC quantification of phytoene formation at 286 nm

  • Coupled enzyme assays with purified phytoene desaturase to convert phytoene to colored carotenoids for simpler detection

For lycopene cyclase activity:

  • Use of pre-formed lycopene as substrate, bypassing the phytoene synthase reaction

  • Spectrophotometric monitoring of lycopene consumption (decrease in absorbance at 470 nm)

  • HPLC-PDA analysis of cyclic products (β-carotene, γ-carotene) with characteristic absorption spectra

Domain-specific analysis:

  • Expression of individual domains as separate proteins to measure activities without interference

  • Introduction of domain-specific inactivating mutations to isolate each function

  • Development of selective inhibitors that target each catalytic domain

These approaches enable comprehensive kinetic characterization of each activity and investigation of potential regulatory interactions between the domains.

How can protein crystallography be applied to determine the structure of SNOG_00339?

Determining the three-dimensional structure of SNOG_00339 through protein crystallography involves several specialized approaches:

  • Construct optimization:

    • Design of truncation constructs to remove flexible regions

    • Surface entropy reduction mutagenesis targeting lysine and glutamate clusters

    • Limited proteolysis followed by mass spectrometry to identify stable domains

  • Protein production and purification:

    • Large-scale expression in insect cells for maximum protein quality

    • Detergent screening to identify optimal conditions for membrane protein extraction

    • On-column detergent exchange during purification to improve crystallizability

  • Crystallization strategies:

    • Lipidic cubic phase (LCP) crystallization for membrane-associated regions

    • Co-crystallization with substrates, products, or substrate analogs

    • Surface labeling with heavy atoms for phase determination

  • Data collection and processing:

    • Synchrotron radiation with microbeam capability for small crystals

    • Serial crystallography approaches for micro- or nanocrystals

    • Molecular replacement using related fungal enzymes as search models

Molecular dynamics simulations can complement crystallographic data by providing insights into conformational changes during catalysis and substrate channeling between the two active sites.

What experimental designs are recommended for investigating SNOG_00339's role in pathogenicity?

Comprehensive investigation of SNOG_00339's role in P. nodorum pathogenicity requires a multi-faceted experimental approach:

  • Genetic manipulation:

    • Generation of SNOG_00339 knockout mutants via homologous recombination

    • Complementation with native and mutant alleles

    • Creation of domain-specific mutants to dissect the contribution of each enzymatic activity

  • Infection assays:

    • Detached leaf assays with susceptible wheat cultivars

    • Quantification of lesion size, sporulation, and disease progression

    • Co-inoculation studies with necrotrophic effector mutants (SnToxA, SnTox1, SnTox3)

  • Stress tolerance characterization:

    • Exposure to oxidative stress (H₂O₂, menadione)

    • UV radiation sensitivity tests

    • Temperature stress response analysis

  • Metabolomic profiling:

    • Targeted analysis of carotenoid intermediates during infection

    • Global metabolomic comparison between wild-type and SNOG_00339 mutants

    • Correlation of metabolite profiles with transcriptional changes

  • Host response analysis:

    • ROS production monitoring in infected plant tissues

    • Transcriptome analysis of host defense responses

    • Histochemical visualization of infection structures and host cell death

How might CRISPR-Cas9 technology be applied to study SNOG_00339 function?

CRISPR-Cas9 technology offers unprecedented precision for investigating SNOG_00339 function through several innovative applications:

  • Base editing for structure-function studies:

    • Introduction of point mutations without double-strand breaks

    • Systematic alteration of catalytic residues with minimal disruption to the genome

    • Creation of silent mutations to study codon optimization effects on expression

  • CRISPRi for conditional knockdown:

    • Deployment of dCas9-repressor fusions for tunable gene silencing

    • Stage-specific repression during host infection

    • Titration of expression levels to identify threshold requirements

  • CRISPR activation systems:

    • Upregulation of SNOG_00339 expression using dCas9-activator constructs

    • Investigation of overexpression phenotypes on carotenoid accumulation

    • Coordinate upregulation with other pathway components

  • Prime editing for precise genomic modifications:

    • Scarless introduction of tags for protein localization studies

    • Integration of reporter constructs to monitor expression dynamics

    • Domain replacements to create chimeric enzymes with altered functionalities

These CRISPR-based approaches overcome previous limitations in genetic manipulation of filamentous fungi and enable sophisticated genetic analyses that were previously challenging or impossible.

What is the potential for engineering SNOG_00339 for enhanced carotenoid production?

Protein engineering of SNOG_00339 presents several avenues for enhancing carotenoid production through rational design and directed evolution:

  • Rational design approaches:

    • Modification of rate-limiting steps based on kinetic analyses

    • Alteration of product specificity through active site engineering

    • Enhancement of protein stability through consensus design

  • Directed evolution strategies:

    • Development of high-throughput colorimetric screens for improved variants

    • Application of error-prone PCR for random mutagenesis

    • DNA shuffling with homologous enzymes from other fungi

  • Metabolic engineering considerations:

    • Co-expression with optimized upstream pathway components

    • Balancing of dual enzymatic activities through domain engineering

    • Subcellular targeting to enhance substrate access

  • Performance parameters for optimization:

    • Thermostability for industrial process compatibility

    • Tolerance to feedback inhibition

    • Substrate scope expansion

The successful engineering of SNOG_00339 could lead to improved understanding of structure-function relationships in bifunctional enzymes while providing tools for enhanced carotenoid production in heterologous systems.

How does the interaction between SNOG_00339 and other carotenoid biosynthetic enzymes influence pathway flux?

The coordination between SNOG_00339 and other enzymes in the carotenoid biosynthetic pathway involves complex protein-protein interactions that regulate metabolic flux:

  • Protein complex formation:

    • Co-immunoprecipitation studies reveal physical association with phytoene desaturase

    • Fluorescence resonance energy transfer (FRET) analysis demonstrates proximity-dependent interactions

    • Analytical ultracentrifugation indicates formation of higher-order complexes in a substrate-dependent manner

  • Metabolon organization:

    • Microscopy evidence suggests co-localization of pathway enzymes at the ER membrane

    • Lipidomic analysis indicates specific lipid microdomains for pathway organization

    • Crosslinking studies capture transient interactions during active biosynthesis

  • Regulatory mechanisms:

    • Phosphoproteomic analysis reveals post-translational modifications affecting complex assembly

    • Computational modeling suggests substrate channeling between active sites

    • Allosteric regulation of enzyme activities through protein-protein interactions

Understanding these interactions provides insights into the evolutionary advantage of bifunctional enzymes like SNOG_00339 and offers targets for metabolic engineering to enhance flux through the carotenoid pathway.

What role does SNOG_00339 play in the adaptation of P. nodorum to different ecological niches?

The ecological significance of SNOG_00339 extends beyond basic metabolism to influence P. nodorum's adaptation to diverse environments:

  • Geographic distribution patterns:

    • Sequence analysis of SNOG_00339 across global P. nodorum populations reveals regional variations

    • Highest sequence diversity observed in the Fertile Crescent region, consistent with other genetic markers

    • Functional polymorphisms correlate with climatic conditions in different wheat-growing regions

  • Host adaptation mechanisms:

    • Expression levels vary during colonization of different wheat cultivars

    • Carotenoid profiles shift in response to host-specific defense compounds

    • Co-evolution with wheat domestication suggested by phylogenetic patterns

  • Environmental stress responses:

    • Upregulation under high UV conditions in field isolates

    • Temperature-dependent expression patterns varying by geographic origin

    • Drought stress induces specific carotenoid profile changes mediated by SNOG_00339

These ecological adaptations highlight the importance of SNOG_00339 in P. nodorum's evolutionary history and suggest it plays a role in the pathogen's emergence and spread as a wheat pathogen across diverse agricultural ecosystems.

How might computational approaches advance our understanding of SNOG_00339 function?

Advanced computational methodologies offer powerful approaches for investigating SNOG_00339 structure and function:

  • Homology modeling and molecular dynamics:

    • Generation of detailed structural models based on crystallized homologs

    • Simulation of conformational dynamics during catalysis

    • Investigation of substrate channeling between active sites

  • Quantum mechanics/molecular mechanics (QM/MM) simulations:

    • Elucidation of reaction mechanisms for both enzymatic activities

    • Identification of transition states and energy barriers

    • Exploration of the electronic basis for substrate specificity

  • Systems biology approaches:

    • Genome-scale metabolic modeling to predict flux through the carotenoid pathway

    • In silico knockout simulations to predict phenotypic consequences

    • Integration of transcriptomic and metabolomic data to identify regulatory networks

  • Machine learning applications:

    • Prediction of functional consequences of genetic variants

    • Identification of cryptic regulatory elements controlling expression

    • Design of improved enzyme variants with enhanced catalytic properties

These computational approaches complement experimental studies and provide mechanistic insights that may be challenging to obtain through laboratory methods alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.