Recombinant Phaeosphaeria nodorum Cytochrome c oxidase assembly protein COX16, mitochondrial (COX16)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Profile

Recombinant Phaeosphaeria nodorum COX16 is a synthetic version of the mitochondrial COX16 protein, engineered for research and diagnostic applications. It belongs to a conserved family of proteins critical for the biogenesis of cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain. Key features include:

  • Source Organism: Phaeosphaeria nodorum (strain SN15/ATCC MYA-4574/FGSC 10173), a fungal pathogen .

  • Gene ID: SNOG_08351; Uniprot ID: Q0UIR3 .

  • Amino Acid Sequence: 116 residues (region 11–116), with a predicted single transmembrane domain .

PropertyDetails
Host SystemsCell-free expression systems, E. coli, yeast, or mammalian cells .
Purity≥85% (SDS-PAGE validated) .
Storage-20°C to -80°C in Tris-based buffer with 50% glycerol .

2.1. Role in Copper Delivery and Assembly

  • Copper Metallation: Facilitates copper insertion into the CuA site of COX2 via interaction with metallochaperones SCO1 and COA6 .

  • Assembly Intermediates: Associates with MITRAC complexes (mitochondrial translation regulation assembly intermediates) containing COX1, enabling COX2 integration into the COX1 module .

2.2. Subcellular Localization

  • Mitochondrial Inner Membrane: Anchored with its C-terminus facing the intermembrane space (IMS), confirmed via protease protection and carbonate extraction assays .

  • Human vs. Yeast: Unlike yeast COX16, human COX16 lacks a canonical N-terminal mitochondrial targeting sequence .

Clinical and Pathological Relevance

COX16 deficiency is linked to severe mitochondrial disorders, as demonstrated in human and model organism studies:

Clinical FeatureMechanismReferences
Hypertrophic CardiomyopathyImpaired COX2 metallation disrupts ATP production in cardiac muscle .
Neonatal Lactic AcidosisCOX deficiency causes pyruvate accumulation due to respiratory chain dysfunction .
EncephalopathyMitochondrial dysfunction in neurons leads to neurological deficits .

Case Study:
A homozygous nonsense variant (c.244C>T, p.Arg82*) in COX16 caused fatal neonatal encephalopathy, cardiomyopathy, and isolated COX deficiency. Lentiviral rescue with wild-type COX16 restored COX activity in patient fibroblasts .

4.1. Biochemical Studies

  • ELISA and Western Blotting: Recombinant COX16 is used as an antigen in immunoassays to detect anti-COX16 antibodies in mitochondrial diseases .

  • Pulldown Assays: Demonstrates interaction with SCO1, COA6, and MITRAC12 in COX2 assembly .

4.2. Comparative Analysis with Other Organisms

OrganismCOX16 FunctionKey Differences
Saccharomyces cerevisiaeCritical for COX1 assembly intermediates and supercomplex formation .Complements yeast mutants; lacks human COX16’s redundancy .
Homo sapiensPartially redundant; copper supplementation rescues some assembly defects .No clear N-terminal targeting sequence .

5.1. Knockout Models

  • COX16 KO Cells:

    • Phenotype: Reduced COX2 and COX6C levels; impaired COX activity (~50% of wild-type) .

    • BN-PAGE Results: Accumulation of MITRAC12 (COX1 assembly intermediate) and loss of mature COX .

  • Copper Supplementation: Restores COX2 stability and subunit levels in KO cells, highlighting COX16’s role in copper delivery .

5.2. Pathogenic Mutant Interactions

  • SCO1 Mutants (e.g., G132S, P174L): Fail to bind COX16, disrupting CuA site formation .

  • COA6 Mutants (e.g., W59C, W66R): Lose association with both COX16 and COX2, impairing assembly .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. If you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is preferred, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
COX16; SNOG_08351; Cytochrome c oxidase assembly protein COX16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
11-116
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
COX16
Target Protein Sequence
AATLPNSIAARYRKQLQKHPFLLFGLPFMATIVAGSFMLTPATALRYERYDRKNQQITQE EAMGLRQERRKVNMKDEYYRLQAKDLEDWEQRRVKRLPGEPDGTLV
Uniprot No.

Target Background

Function
This protein is essential for the assembly of mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may participate in merging the COX1 and COX2 assembly lines.
Database Links
Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the molecular function of COX16 in mitochondrial processes?

COX16 serves as an assembly factor for cytochrome c oxidase (complex IV), the terminal complex of the mitochondrial respiratory chain. Research demonstrates that COX16 participates specifically in the biogenesis of complex IV through multiple mechanisms:

  • Interacts directly with newly synthesized COX2 and its copper center-forming metallochaperones including SCO1, SCO2, and COA6

  • Facilitates recruitment of SCO1 to the COX2 module in a COX16-dependent manner

  • Participates in merging the initially independent COX1 and COX2 assembly pathways

  • Assists in the formation of the copper delivery route for the COX2 module

Loss of COX16 function results in severe reduction of mature cytochrome c oxidase, with most COX1 remaining trapped in the MITRAC assembly intermediate complex rather than progressing to the fully assembled complex IV .

What is the subcellular localization of COX16?

COX16 is specifically localized to the inner mitochondrial membrane. Experimental evidence from hypo-osmotic swelling and carbonate extraction studies shows that:

  • COX16 is present in isolated mitochondria

  • The protein only becomes accessible to protease treatment when the outer membrane is disrupted

  • COX16 remains resistant to carbonate extraction, indicating it is an integral membrane protein rather than a peripherally associated one

Based on these characteristics and its predicted single transmembrane span, COX16 is positioned as an inner mitochondrial membrane protein with its C-terminus facing the intermembrane space (IMS) . This topology is crucial for its interactions with other assembly factors and complex IV subunits during the biogenesis process.

What experimental models are available for studying COX16 deficiency?

Several experimental systems have been developed to investigate COX16 function:

  • CRISPR/Cas9-generated knockout cell lines: COX16−/− HEK-293T cells show marked reduction in complex IV subunits (particularly COX2) and severely decreased cytochrome c oxidase activity (~65% compared to wild type)

  • Patient-derived fibroblasts: Cells from patients with homozygous nonsense variant c.244C>T(p.Arg82*) in COX16 exhibit:

    • Absence of COX16 protein expression

    • Complete loss of holo-complex IV

    • Reduced expression of complex IV subunits including COX1, COX2, COX4, and COX5A

  • Complementation models: Patient fibroblasts transduced with wild-type COX16 cDNA show:

    • Clear increase of fully assembled complex IV

    • Increased levels of complex IV subunits (COX1, COX2, COX4, COX5A)

    • Complete rescue of complex IV activity

These models provide essential tools for investigating the pathophysiology of COX16 deficiency and potential therapeutic approaches.

How does COX16 contribute to copper delivery in the COX2 module?

The precise mechanism by which COX16 facilitates copper delivery to the COX2 module remains under investigation, but current evidence suggests two potential models:

Model 1: Indirect role through metallochaperone recruitment

  • Rather than directly binding copper, COX16 appears to recruit the metallochaperone SCO1 to the COX2 subunit

  • Experimental evidence shows that supplementing copper does not increase complex IV activity in the absence of COX16, supporting the recruitment hypothesis

  • COX16 lacks the conserved cysteine and histidine residues typically present in copper-binding motifs

Model 2: Assembly module integration

  • COX16 may facilitate the merging of copper-loaded COX2 into the maturing complex IV

  • Evidence from 2D-BN-PAGE/SDS-PAGE immunoblotting shows accumulation of COX1 in the mitochondrial translation regulation assembly intermediate when COX16 is absent

  • Introduction of wild-type COX16 results in significant increase of COX1 in the holo-complex and detection of COX2 in fully assembled complex IV

The interaction of COX16 with both COX2 and copper chaperones (SCO1, SCO2, COA6) positions it as a crucial coordinator in the copper delivery pathway essential for complex IV assembly.

What protein-protein interactions define COX16 function during cytochrome c oxidase assembly?

COX16 engages in several critical protein-protein interactions during complex IV biogenesis:

Table 1: Key COX16 Protein Interactions in Complex IV Assembly

Interaction PartnerFunctional SignificanceExperimental Evidence
COX2Direct interaction with newly synthesized COX2Co-immunoprecipitation after radiolabeling of mitochondrial translation products
SCO1Recruitment to COX2 is COX16-dependentLoss of interaction with SCO1 mutants (G132S, P174L) while maintaining COX2 association
SCO2Part of copper center-forming metallochaperonesAssociation with COX16 during complex IV assembly
COA6Copper chaperone in COX2 metallationPathogenic variants (W59C, W66R) lose COX16 interaction with concomitant loss of COX2 binding
COX1 modulesFound in COX1-containing assembly intermediatesPresent in COX1 assembly stages, suggesting role in module integration

The interactions between COX16 and metallochaperones are particularly significant, as patient-derived mutations in these proteins affect their association with COX16. For example, pathogenic mutations in SCO1 (G132S and P174L) cause considerable loss of association with COX16 while maintaining COX2 binding, suggesting the disease mechanism may involve disrupted COX16-SCO1 interaction rather than defective COX2 recruitment .

How does COX16 deficiency manifest in mitochondrial disease?

COX16 deficiency has been directly linked to severe mitochondrial disease with a distinctive clinical presentation:

  • Clinical features: Hypertrophic cardiomyopathy, encephalopathy, and severe fatal lactic acidosis

  • Biochemical hallmark: Isolated complex IV deficiency

  • Genetic basis: Homozygous nonsense variant c.244C>T(p.Arg82*) in COX16

  • Molecular consequences:

    • Absence of COX16 protein expression

    • Complete loss of holo-complex IV

    • Reduced levels of multiple complex IV subunits (COX1, COX2, COX4, COX5A)

The pathophysiology stems from impaired complex IV assembly, which disrupts mitochondrial respiration and oxidative phosphorylation. Tissues with high energy demands, such as heart and brain, are particularly affected.

The disease-causing variant has an extremely low allele frequency (0.0034% in gnomAD) with no homozygotes reported in population databases, consistent with the severe phenotype observed in affected patients .

What methods can be used to assess the impact of COX16 deficiency on mitochondrial function?

Multiple complementary approaches can be employed to evaluate the consequences of COX16 deficiency:

  • Blue Native-PAGE (BN-PAGE) and Western blotting

    • Reveals absence of fully assembled complex IV

    • Demonstrates accumulation of COX1 in MITRAC assembly intermediate

    • Allows visualization of complex IV assembly stages using antibodies against different subunits

  • In-gel activity staining

    • Shows significantly reduced complex IV activity

    • Can detect changes in other respiratory chain complexes (e.g., slightly increased complex I activity at supercomplex level)

    • Enables functional assessment of assembled complexes

  • Quantitative enzyme assays

    • ELISA measurements show reduction of cytochrome c oxidase to ~50% in COX16 knockout cells

    • Direct activity measurements reveal reduction to ~65% compared to controls

    • Provides precise quantification of enzyme levels and function

  • Cellular growth assays

    • COX16−/− cells display growth retardation on both glucose- and galactose-containing media

    • Galactose media forces cells to rely on oxidative phosphorylation, accentuating mitochondrial defects

  • Complementation studies

    • Lentiviral transduction with wild-type COX16 cDNA rescues complex IV biosynthesis in patient fibroblasts

    • Confirms causality between COX16 deficiency and observed phenotypes

    • Allows assessment of variant pathogenicity

  • 2D-BN-PAGE/SDS-PAGE immunoblotting

    • Reveals accumulation of COX1 in assembly intermediates

    • Shows nearly undetectable COX2 in the holo-complex

    • Provides detailed analysis of assembly pathway blockage points

What structural and functional differences exist between fungal and human COX16?

Despite serving similar functions in complex IV assembly, fungal and human COX16 proteins exhibit several important differences:

Table 2: Comparative Analysis of Fungal versus Human COX16

FeatureFungal COX16 (e.g., Phaeosphaeria nodorum, S. cerevisiae)Human COX16Functional Implications
Mitochondrial targetingContains N-terminal presequence Lacks predictable N-terminal presequence Different import mechanisms
Amino acid sequenceExample from P. nodorum: AATLPNSIAARYRKQLQKHPFL LFGLPFMATIVAGSFLTP... Differs sufficiently to prevent cross-species complementationSpecies-specific interactions
Cross-complementation-Does not complement yeast Cox16 mutant Evolutionary divergence of interaction partners
Transmembrane topologyInner membrane proteinInner membrane protein with C-terminus facing intermembrane space Conserved membrane association

How can recombinant COX16 be used in experimental protocols?

Recombinant Phaeosphaeria nodorum COX16 protein provides a valuable research tool that can be utilized in various experimental applications:

  • Complementation studies

    • Lentiviral transduction of wild-type COX16 cDNA (with or without tags) into patient fibroblasts

    • Demonstrates rescue of complex IV assembly and activity in COX16-deficient cells

    • Confirms the causal relationship between COX16 variants and disease phenotypes

  • Protein-protein interaction analysis

    • In vitro binding assays to study interactions with metallochaperones (SCO1, SCO2, COA6)

    • Determination of binding domains through truncation or mutation analyses

    • Investigation of effects of patient-derived mutations on protein interactions

  • Antibody development and validation

    • Generation of antibodies against recombinant COX16 for immunological detection

    • Validation of antibody specificity using knockout cell lines as controls

    • Application in techniques like immunoblotting, immunoprecipitation, and immunocytochemistry

  • Structure-function relationship studies

    • Comparison of fungal and human COX16 to identify conserved functional domains

    • Site-directed mutagenesis to assess the impact of specific residues on function

    • Characterization of the transmembrane domain and its role in protein localization

For optimal experimental results, recombinant COX16 should be stored at -20°C in Tris-based buffer with 50% glycerol, and repeated freeze-thaw cycles should be avoided .

What techniques are most effective for studying COX16's role in complex IV assembly?

Several specialized techniques have proven particularly effective for investigating COX16's function:

  • Radiolabeling of mitochondrial translation products

    • Pulse-chase experiments with 35S-methionine to track newly synthesized mitochondrial proteins

    • Immunoprecipitation of COX16 followed by SDS-PAGE and autoradiography

    • Reveals specific enrichment of COX2 in COX16 immunoprecipitates, especially in assembly-defective backgrounds

  • 2D-BN-PAGE/SDS-PAGE immunoblotting

    • First dimension: separation of native complexes by BN-PAGE

    • Second dimension: SDS-PAGE to resolve individual subunits

    • Allows visualization of complex IV assembly intermediates and identification of blockage points

  • CRISPR/Cas9-mediated gene disruption

    • Generation of complete COX16 knockout cell lines (e.g., targeting first exon)

    • Analysis of resulting phenotypes at biochemical and cellular levels

    • Creation of isogenic control and mutant cell lines for comparative studies

  • In-gel activity staining

    • Separation of solubilized respiratory chain complexes by BN-PAGE

    • Incubation with substrates that form colored precipitates upon enzyme activity

    • Enables functional assessment of complex IV alongside complexes I and V

  • Copper supplementation experiments

    • Testing whether copper supplementation can bypass the need for COX16

    • Helps distinguish between direct copper delivery versus metallochaperone recruitment models

    • Provides insights into the precise mechanism of COX16 function

These methodological approaches, especially when used in combination, provide comprehensive insights into the molecular mechanisms by which COX16 facilitates complex IV assembly and the consequences of its dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.