Recombinant Phaeosphaeria nodorum Dol-P-Man:Man (5)GlcNAc (2)-PP-Dol alpha-1,3-mannosyltransferase (ALG3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Phaeosphaeria nodorum Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol α-1,3-Mannosyltransferase (ALG3)

The recombinant Phaeosphaeria nodorum ALG3 enzyme is a bioengineered version of the endogenous α-1,3-mannosyltransferase involved in the biosynthesis of N-linked glycans. This enzyme catalyzes the transfer of a mannose residue from dolichyl phosphate (Dol-P-Man) to the lipid-linked oligosaccharide Man(5)GlcNAc(2)-PP-Dol, forming Man(6)GlcNAc(2)-PP-Dol, a critical intermediate in the dolichol pathway . The recombinant protein is produced in E. coli with a His-tag for purification and is full-length (1–609 amino acids) .

Enzymatic Activity

ALG3 belongs to the glycosyltransferase family (EC 2.4.1.258) and specifically adds the first α-1,3-linked mannose to the core N-glycan structure during its assembly in the endoplasmic reticulum . Its activity is conserved across eukaryotes, including fungi like Phaeosphaeria nodorum, where it is essential for glycoprotein maturation .

ParameterValueSource
EC Number2.4.1.258
SubstrateDol-P-Man + Man(5)GlcNAc(2)-PP-Dol
ProductMan(6)GlcNAc(2)-PP-Dol
Reaction TypeGlycosyltransferase

Ortholog Conservation

ALG3 shows high sequence similarity with orthologs in diverse organisms, including fungi, plants, and mammals, indicating evolutionary conservation . Key ortholog groups include:

Group IDSpeciesBitscoreInparalog ScoreDescription
1004Phaeosphaeria nodorum2171.0Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol α-1,3-mannosyltransferase
3027Hortaea werneckii3601.0Same as above
3816Leptosphaeria maculans5041.0Same as above

Production and Biochemical Features

The recombinant Phaeosphaeria nodorum ALG3 is produced in E. coli and purified via affinity chromatography using its His-tag . Key specifications include:

FeatureDetailSource
Host OrganismE. coli
TagHis-tag
Protein LengthFull-length (1–609 amino acids)
Molecular Weight~76.5 kDa (estimated)
Storage BufferTris-HCl, reduced glutathione (pH 8.0)

Role in N-Glycan Biosynthesis

ALG3 is critical for the assembly of the lipid-linked oligosaccharide (LLO) core. In Pichia pastoris, deletion of ALG3 results in truncated Man(5)GlcNAc(2) structures, which are resistant to further Golgi processing, highlighting its necessity in glycoprotein maturation .

Pathogenic and Evolutionary Insights

In Phaeosphaeria nodorum, ALG3 is implicated in fungal pathogenicity, as N-glycosylation defects may impair virulence factors. Ortholog studies reveal close homology with Leptosphaeria maculans (bitscore = 504), suggesting functional conservation in plant-pathogenic fungi .

Disease Association

While not directly studied in Phaeosphaeria nodorum, human ALG3 mutations are linked to congenital disorders of glycosylation (CDG-Id), underscoring its universal role in glycan biosynthesis .

Comparative Analysis with Other ALG3 Orthologs

SpeciesHost SystemTagLengthApplication
Homo sapiensWheat GermGST1–438 amino acidsCDG-Id research, antibody production
Mus musculusHEK293His/FcFull-lengthGlycosylation pathway studies
Phaeosphaeria nodorumE. coliHis1–609 amino acidsFungal glycosylation, pathogenicity

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ALG3; SNOG_16505; Dol-P-Man:Man(5GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; Asparagine-linked glycosylation protein 6; Dol-P-Man-dependent alpha(1-3-mannosyltransferase; Dolichyl-P-Man:Man(5GlcNAc(2-PP-dolichyl mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
ALG3
Target Protein Sequence
MSKLSPALKQLINAAHSRPGPVPAPPRIQAVYQRIQEEATERKLGRPSWLGISTAATMTM NSPESMIALYNSTSASRPENESVQIAEFMREIGLKCIGFNGIPRTINMLNAFRASLPPTI ASSLNTTPTRSPSPQNILDTNTRGRALWDAIYRPLETKLIDKLGDAHPDLPVFIINQEYG GLFTDPPGKPGAKVGRVTTSLVAITCLRAQQGVGPQVLSHVFGLRKGWEDGTWKEEPEAG SEEAIRWLVSDEGCTWVLEKVDELVEALGGGAGTLSPAIDEKPKELTTTKTMSLINRVRD LATNDEHTRWMIPLLLVVDAALCGVVIEKIPYTEIDWTTYMQHIALIIKGERDYTKITGS TGPLVYPGAHVWIYKQLFKITDEGRDIQRAQYIFALVYLGTLALVFQCYRKARVPPYVFP LLILSKRLHSIFLLRCFNDCFAVLGLFAALFCYQRDQWHVGSFLFATGLNVKMSLLLPLP AMGVLMIMKLGSREAMTHAMIIFQTTVLFGYPFRKAAFSYFGRAFELSRQFTYKWTVNWR FVSEETFLSKPFALGLLSVHVTLLITFFLTRWIKPSKRTPKQFLKIIMPQAEPRDQDTMA LRITPNLHT
Uniprot No.

Target Background

Function
This enzyme catalyzes the addition of the first Dol-P-Man derived mannose in an alpha-1,3 linkage to Man(5)GlcNAc(2)-PP-Dol.
Database Links
Protein Families
ALG3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ALG3 and what is its primary function in glycosylation pathways?

ALG3 (Asparagine-Linked Glycosylation 3) is a glycosyltransferase enzyme that catalyzes a critical step in the N-glycosylation pathway. Specifically, it converts Man(5)GlcNAc(2)-Dol-PP to Man(6)GlcNAc(2)-Dol-PP in the endoplasmic reticulum (ER) . This reaction represents the addition of the first alpha-1,3-linked mannose residue to the growing dolichol-linked oligosaccharide precursor during N-glycan assembly. The enzyme is essential for proper protein glycosylation, which affects protein folding, stability, and function.

To study this enzyme, researchers typically employ recombinant expression systems, enzymatic assays measuring substrate-to-product conversion rates, and structural biology approaches. The catalytic mechanism involves the transfer of mannose from a dolichol-phosphate-mannose donor to the acceptor oligosaccharide.

How conserved is ALG3 across different species?

ALG3 is highly conserved across eukaryotic organisms, indicating its fundamental importance in N-glycosylation. Research shows significant homology between ALG3 proteins from:

  • Saccharomyces cerevisiae (budding yeast)

  • Pichia pastoris (yeast expression system)

  • Drosophila melanogaster (fruit fly, known as "Neighbour of TID")

  • Mammals (human, mouse, rat)

Human ALG3 (hNOT/ALG3) shows approximately 33% identity with the yeast ALG3 protein . In humans, ALG3 encodes two translated transcripts with different N-termini . The phosphorylation sites Ser11/Ser13 are particularly well conserved among mammalian species, suggesting functional importance in regulatory mechanisms .

For experimental approaches studying evolutionary conservation, researchers commonly employ complementation studies, where the ALG3 gene from one species is expressed in another species with ALG3 deletion to assess functional rescue.

What are the recommended methods for recombinant expression and purification of ALG3?

For successful recombinant expression and purification of ALG3, researchers should consider the following methodological approach:

  • Expression System Selection: Since ALG3 is a membrane-associated glycosyltransferase localized to the ER, eukaryotic expression systems are preferable. Pichia pastoris has been successfully used due to its ability to perform proper protein folding and post-translational modifications .

  • Vector Design: Include appropriate affinity tags (His, FLAG, or HA) to facilitate purification. The search results indicate successful use of HA/FLAG-tagged ALG3 in mammalian expression systems .

  • Membrane Protein Solubilization: Use gentle detergents like digitonin, DDM, or CHAPS to extract the membrane-associated enzyme while maintaining its native conformation.

  • Purification Strategy:

    • Affinity chromatography (using the incorporated tags)

    • Size exclusion chromatography to enhance purity

    • Consider using lipid nanodiscs for maintaining enzymatic activity

  • Activity Verification: Implement enzymatic assays measuring the conversion of Man(5)GlcNAc(2)-Dol-PP to Man(6)GlcNAc(2)-Dol-PP.

When working specifically with Phaeosphaeria nodorum ALG3, attention should be paid to codon optimization for the expression host and potential fungal-specific post-translational modifications.

What techniques are most effective for assessing ALG3 enzymatic activity?

Several complementary approaches provide robust assessment of ALG3 enzymatic activity:

  • In vitro enzymatic assays: Using purified recombinant ALG3 with radiolabeled or fluorescently labeled substrates to monitor the conversion of Man(5)GlcNAc(2)-Dol-PP to Man(6)GlcNAc(2)-Dol-PP.

  • Lectin binding assays: As demonstrated in the research, lectins like Galanthus nivalis agglutinin (GNA), Concanavalin A (ConA), and Griffonia Simplifigfolia Lectin I (GSL-I) can be used to assess the impact of ALG3 on glycan profiles .

  • Mass spectrometry analysis: High-resolution mass spectrometry can identify specific glycan structures before and after ALG3 activity.

  • Genetic complementation: Especially in yeast models, where alg3 deletion mutants exhibit characteristic glycosylation defects that can be rescued by functional ALG3 .

  • Cell-based glycosylation assessment: Monitoring glycoprotein migration patterns by SDS-PAGE before and after ALG3 manipulation (as seen with the differential binding patterns at multiple molecular weights in GNA, ConA, and GSL-I lectin studies) .

The choice of method depends on whether you're studying purified enzyme kinetics or cellular consequences of ALG3 activity.

How is ALG3 regulated by post-translational modifications, particularly phosphorylation?

Recent research has revealed that ALG3 is regulated by phosphorylation as part of the PI3K/AKT signaling pathway. Key findings include:

  • AKT-mediated phosphorylation sites: ALG3 contains two high-quality basophilic phosphorylation motifs at Ser11/Ser13 that conform to the optimal AKT consensus motif (RXRXXS/T) .

  • Stimulus-dependent phosphorylation: Insulin stimulation induces phosphorylation of ALG3 in a time-dependent manner, coincident with PI3K/AKT activation .

  • Pathway specificity: ALG3 phosphorylation is blocked by PI3K inhibitor (GDC-0941) and AKT inhibitor (GDC-0068), but not by rapamycin (MTORC1 inhibitor), indicating that ALG3 phosphorylation occurs specifically downstream of AKT, not S6K .

  • Direct AKT substrate confirmation: In vitro kinase assays demonstrate that recombinant active GST-AKT1 directly phosphorylates wild-type ALG3 but not ALG3 mutants where Ser11 and/or Ser13 are replaced with alanine .

This regulation represents a novel link between growth factor signaling and protein glycosylation, suggesting that cellular glycosylation patterns may be dynamically regulated in response to environmental cues.

For studying this regulation, researchers should consider using phospho-specific antibodies, phosphomimetic and phospho-deficient mutants, and selective pathway inhibitors.

What protein-protein interactions modulate ALG3 function?

ALG3 engages in various protein-protein interactions that influence its function and cellular localization. Based on yeast two-hybrid studies of human ALG3 (hNOT/ALG3):

  • Self-association: hNOT/ALG3 can form homodimers, which may be important for its function or stability .

  • Interaction partners: Seventeen molecular partners of hNOT-1/ALG3-1 have been identified, including:

    • OSBP and OSBPL9 (oxysterol-binding proteins)

    • LRP1 (low-density lipoprotein receptor-related protein 1)

    • SYPL1 (synaptophysin-like protein 1)

    • CREB3 (transcription factor)

  • Functional implications: The interaction between hNOT-1/ALG3-1 and the N-glycosylated CREB3 precursor is a prerequisite for the proteolytic activation of CREB3 .

  • Compartment-specific interactions: Different post-translationally processed forms of hNOT-1/ALG3-1 interact with distinct partners in different cellular compartments .

For investigating these interactions, co-immunoprecipitation, proximity labeling (BioID/TurboID), and fluorescence resonance energy transfer (FRET) are recommended methodologies beyond the initial yeast two-hybrid screening.

What is the relationship between ALG3 and cancer progression?

ALG3 has emerging connections to cancer biology with several significant findings:

  • Genomic amplification: ALG3 is amplified in multiple cancer types, including lung, breast, ovarian, and esophageal cancers .

  • Prognostic significance: Expression of ALG3 correlates with poor clinical outcomes in breast cancer patients .

  • Molecular mechanism: Depletion of ALG3 induces ER stress and triggers the unfolded protein response (UPR), leading to deregulation of glycoproteins and reduced cell proliferation in breast cancer cells .

  • Signaling integration: As an AKT substrate, ALG3 represents a novel node connecting the frequently dysregulated PI3K pathway to altered glycosylation patterns in cancer cells .

This evidence suggests that ALG3 may contribute to cancer progression by modulating protein glycosylation, thereby affecting various cellular processes including protein folding, secretion, and cell-cell interactions.

For researchers investigating ALG3 in cancer contexts, appropriate methodologies include analysis of patient tumor samples for ALG3 expression levels, correlation with clinical outcomes, functional studies using cancer cell lines with ALG3 modulation, and in vivo tumor models with ALG3 knockdown or overexpression.

How does ALG3 dysfunction contribute to ER stress and the unfolded protein response?

ALG3 dysfunction disrupts proper N-glycosylation, triggering cellular stress responses:

  • Glycosylation defects: Depletion of ALG3 leads to improper glycan formation as evidenced by altered lectin binding patterns . This results in accumulation of incompletely glycosylated proteins in the ER.

  • ER stress induction: The presence of misfolded or incorrectly glycosylated proteins activates the ER stress response .

  • UPR activation: Prolonged ER stress triggers the unfolded protein response (UPR), a coordinated cellular program that aims to restore proteostasis through:

    • Increased expression of chaperones and folding enzymes

    • Attenuation of global protein synthesis

    • Enhanced ER-associated degradation (ERAD) of misfolded proteins

    • If unresolved, activation of apoptotic pathways

  • Cellular consequences: In cancer cells, ALG3 depletion results in reduced cell proliferation, suggesting that cancer cells may be particularly dependent on proper ALG3 function .

For experimental investigation of these processes, researchers should employ markers of ER stress (BiP/GRP78, CHOP, XBP1 splicing), monitor UPR signaling branch activation (PERK, IRE1, ATF6), and assess cell viability and proliferation in response to ALG3 manipulation.

How can CRISPR/Cas9 technology be optimized for studying ALG3 function?

CRISPR/Cas9 offers powerful approaches for investigating ALG3 function, with several optimization considerations:

  • Guide RNA design: The search results demonstrate successful ALG3 knockout using two independent guides (sgALG3_2 and sgALG3_3) . For optimal results:

    • Target early exons to maximize disruption

    • Use algorithms to predict off-target effects

    • Consider the GC content and secondary structure

    • Validate multiple guide RNAs

  • Verification approaches: Since antibodies for endogenous ALG3 detection may be limited, verification requires multi-modal approaches:

    • Quantitative RT-PCR to confirm transcript reduction

    • Functional assays using lectin binding to detect altered glycosylation patterns

    • Phenotypic assays measuring cellular responses (e.g., ER stress markers)

  • Control strategies:

    • Empty vector controls for comparison

    • Rescue experiments using guide-resistant cDNA constructs

    • Use of point mutants (e.g., phosphorylation site mutants) for structure-function analysis

  • Inducible systems: Consider doxycycline-inducible CRISPR systems to study temporal aspects and avoid selection against essential gene loss.

These approaches have been successfully implemented in breast cancer cell models to demonstrate the functional importance of ALG3 in protein glycosylation .

What are the challenges in differentiating ALG3 function across different model organisms?

Researchers face several challenges when studying ALG3 across different model systems:

  • Divergent processing pathways: While the early steps of N-glycosylation (involving ALG3) are conserved, later processing in the Golgi differs significantly between organisms. For example, P. pastoris and S. cerevisiae, despite being closely related yeasts, show different glycan profiles when ALG3 is deleted .

  • Functional homology verification: Experimental evidence for functional homology between species (e.g., between Drosophila and human ALG3) is sometimes lacking and requires complementation studies .

  • Isoform complexity: In humans, ALG3 encodes two translated transcripts with different N-termini, adding complexity not present in simpler model organisms .

  • Substrate specificity differences: Evidence suggests that enzymes involved in glycosylation pathways, such as PpOch1p (which acts downstream of ALG3), can have broader substrate specificity in one species compared to another .

  • Interacting partner variations: The network of protein-protein interactions may differ significantly between species, affecting ALG3 function and regulation.

These considerations necessitate careful selection of model systems based on the specific research question and validation of findings across multiple models when possible.

What analytical approaches best characterize ALG3-dependent glycan structures?

To comprehensively characterize ALG3-dependent glycan structures, researchers should employ a multi-faceted analytical approach:

  • Lectin profiling: Different lectins can bind specific glycan structures:

    • GNA (Galanthus nivalis agglutinin): Binds hybrid glycans, specifically terminal α-1,3 mannose residues

    • ConA (Concanavalin A): Recognizes α-mannose-containing cores and oligomannose-type N-glycans

    • GSL-I (Griffonia Simplifigfolia Lectin I): Binds terminal Galα and GALNAcα

    These can be used in formats including:

    • Lectin blotting of cell lysates

    • Lectin microarrays

    • Flow cytometry with fluorescent lectins

  • Enzymatic digestions: Treatment with specific glycosidases (e.g., α-1,2-mannosidase) can reveal the accessibility and linkage types present in glycan structures .

  • Mass spectrometry: High-resolution MS approaches, including:

    • MALDI-TOF MS for glycan profiling

    • LC-MS/MS for detailed structural analysis

    • Glycopeptide analysis for site-specific glycosylation

  • NMR spectroscopy: For detailed structural determination of purified glycans.

  • Genetic approaches: Comparing glycan profiles between wild-type and ALG3-deficient cells reveals ALG3-dependent structures (as demonstrated in the P. pastoris alg3 deletion mutant studies) .

The combined data from these approaches provides comprehensive structural insights that cannot be achieved with any single method.

How can researchers quantitatively assess ALG3 phosphorylation levels in response to signaling events?

For quantitative assessment of ALG3 phosphorylation in response to signaling stimuli, researchers should consider these methodological approaches:

  • Phospho-specific antibodies: Use antibodies recognizing the phosphorylated AKT substrate motif (RXRXXS*/T*) to detect ALG3 phosphorylation after immunoprecipitation .

  • Mass spectrometry-based phosphoproteomics:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for comparing phosphorylation levels between conditions

    • Parallel Reaction Monitoring (PRM) or Multiple Reaction Monitoring (MRM) for targeted quantification of specific phosphopeptides

    • Phosphoenrichment strategies (TiO2, IMAC) to improve detection sensitivity

  • Pharmacological approach: Comparing phosphorylation levels after treatment with:

    • Pathway stimulators (e.g., insulin)

    • Specific inhibitors (e.g., GDC-0941 for PI3K, GDC-0068 for AKT)

    • Control inhibitors (e.g., rapamycin for mTORC1)

  • Mutational analysis: Using phosphomimetic (S→D/E) and phospho-deficient (S→A) mutants to investigate functional consequences .

  • In vitro kinase assays: Using recombinant active kinases (e.g., GST-AKT1) to directly phosphorylate immunoprecipitated ALG3, allowing quantitative assessment of phosphorylation potential .

The time-dependent phosphorylation dynamics observed after insulin stimulation can be quantified by densitometric analysis of western blots or by MS-based temporal profiling .

What are common challenges in ALG3 detection and how can they be overcome?

Researchers frequently encounter several challenges when trying to detect and study ALG3:

  • Limited antibody availability/quality: As noted in the research, antibodies that robustly detect endogenous ALG3 may be lacking .

    • Solution: Use epitope tagging (HA/FLAG) for recombinant ALG3 detection

    • Solution: Verify knockdown by RT-qPCR rather than protein detection

    • Solution: Develop custom antibodies against unique ALG3 peptides

  • Membrane protein solubilization issues:

    • Solution: Optimize detergent type and concentration (e.g., digitonin, DDM)

    • Solution: Use membrane fractionation before solubilization

    • Solution: Consider native membrane extraction techniques

  • Functional redundancy:

    • Solution: Use multiple approaches to assess function (e.g., lectin binding patterns)

    • Solution: Combine ALG3 manipulation with related glycosylation enzymes

  • Post-translational modification heterogeneity:

    • Solution: Use phospho-specific enrichment techniques

    • Solution: Create stable cell lines expressing phospho-site mutants

  • Background artifacts in glycan analysis:

    • Solution: Include proper controls (e.g., tunicamycin treatment to block all N-glycosylation)

    • Solution: Use orthogonal techniques to confirm glycan structures

These approaches collectively enhance the reliability of ALG3 research findings while addressing common technical hurdles.

How should researchers address contradictory findings regarding ALG3 function across different experimental systems?

When confronted with contradictory findings about ALG3 function in different experimental systems, researchers should implement a systematic approach:

  • Methodological standardization:

    • Harmonize protein expression levels across systems

    • Standardize detection methods and quantification approaches

    • Use identical stimulation conditions and time points

  • Biological context consideration:

    • Acknowledge that glycosylation pathways differ between organisms (e.g., the P. pastoris vs. S. cerevisiae distinction)

    • Document the genetic background of model systems (e.g., presence/absence of och1)

    • Consider tissue-specific or cell-type-specific variations in glycosylation machinery

  • Multi-method validation:

    • Confirm findings using orthogonal techniques

    • Combine genetic, biochemical, and cell biological approaches

    • Use both loss-of-function and gain-of-function strategies

  • Systematic variable isolation:

    • Test human ALG3 in yeast systems and vice versa

    • Generate chimeric proteins to identify domains responsible for differential functions

    • Systematically vary experimental conditions to identify key parameters influencing results

  • Data integration:

    • Develop mathematical models to reconcile seemingly contradictory data

    • Consider kinetic differences that might explain divergent steady-state results

    • Use meta-analysis approaches to identify consistent trends across studies

What are promising approaches for targeting ALG3 in cancer therapeutics?

Based on emerging connections between ALG3 function and cancer biology, several promising therapeutic approaches warrant investigation:

  • Direct inhibition strategies:

    • Small molecule inhibitors targeting ALG3 catalytic activity

    • Peptide-based inhibitors disrupting critical protein-protein interactions

    • Antisense oligonucleotides or siRNA for targeted knockdown

  • Pathway-based approaches:

    • Combination therapy with PI3K/AKT inhibitors, exploiting the newly discovered regulatory connection

    • Synthetic lethality screening to identify contexts where ALG3 inhibition is selectively toxic to cancer cells

    • ER stress amplification strategies to push ALG3-compromised cancer cells toward apoptosis

  • Cancer-specific applications:

    • Focus on cancer types with documented ALG3 amplification (lung, breast, ovarian, esophageal)

    • Stratify patients based on ALG3 expression levels for precision medicine approaches

    • Investigate correlations between ALG3 status and response to existing therapies

  • Therapeutic window considerations:

    • Explore temporary vs. permanent inhibition strategies

    • Investigate tissue-specific delivery approaches

    • Determine minimal ALG3 activity required for normal cell function

These approaches should be evaluated with careful attention to potential on-target toxicities, given ALG3's fundamental role in protein glycosylation across cell types.

How might computational modeling enhance our understanding of ALG3 structure-function relationships?

Computational modeling offers valuable insights into ALG3 structure-function relationships that complement experimental approaches:

  • Structural modeling approaches:

    • Homology modeling based on related glycosyltransferases

    • Molecular dynamics simulations to understand membrane integration and substrate access

    • Quantum mechanical calculations of the catalytic mechanism

    • Prediction of post-translational modification effects on structure

  • Systems biology integration:

    • Pathway modeling of N-glycosylation with ALG3 as a key node

    • Network analysis of ALG3 interactors in different cellular contexts

    • Multi-scale modeling linking glycosylation to cellular phenotypes

  • Sequence-structure-function analysis:

    • Evolutionary conservation mapping onto structural models

    • Identification of co-evolving residues indicating functional coupling

    • Prediction of regulatory sites beyond the known Ser11/Ser13 phosphorylation sites

  • Drug discovery applications:

    • Virtual screening for ALG3 inhibitors

    • Pharmacophore modeling based on substrate recognition

    • Prediction of resistance mechanisms to guide inhibitor design

  • Machine learning integration:

    • Deep learning approaches to predict glycosylation patterns based on ALG3 activity

    • Classification of glycoproteins most affected by ALG3 dysregulation

    • Pattern recognition in glycomics data to identify ALG3-specific signatures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.