Recombinant Phaeosphaeria nodorum Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Phaeosphaeria nodorum Formation of Crista Junctions Protein 1 (FCJ1)

Recombinant Phaeosphaeria nodorum Formation of crista junctions protein 1 (FCJ1) is a protein component of the MICOS complex, which is located in the mitochondrial inner membrane and is crucial for maintaining cristae. Crista junctions (CJs) are tubular invaginations in the inner membrane of mitochondria that connect the inner boundary with the cristae membrane, and these elements are critical for mitochondrial function . In mammals, FCJ1 is also known as mitofilin .

FCJ1 and the TOB/SAM Complex

The C-terminal domain of FCJ1 interacts with Tob55 of the translocase of outer membrane β-barrel proteins (TOB)/sorting and assembly machinery (SAM) complex, which is required for inserting β-barrel proteins into the outer membrane . Although the biogenesis of β-barrel proteins is not significantly affected without FCJ1, down-regulation of the TOB/SAM complex leads to altered cristae morphology and a moderate reduction in the number of CJs .

The association of the TOB/SAM complex with contact sites depends on the presence of FCJ1 . The C-terminal domain of FCJ1 is critical for the interaction of FCJ1 with the TOB/SAM complex and thereby stabilizes CJs in close proximity to the outer membrane .

FCJ1's Role in Crista Junction Formation and Architecture

Overexpression of FCJ1 leads to an increased number of CJs and alters their molecular architecture, while down-regulation results in a progressive decrease in the number of CJs and cristae branches . Cells lacking FCJ1 lack CJs, exhibit concentric stacks of inner membrane in the mitochondrial matrix, and show increased levels of F1FO–ATP synthase supercomplexes .

ConditionObservation
Overexpression of FCJ1Increased number of CJs, branching of cristae, enlargement of CJ diameter
Down-regulation of FCJ1Progressive decrease of the number of CJs and cristae branches
Cells lacking FCJ1 (Δfcj1)Absence of CJs, concentric stacks of inner membrane, increased levels of F1FO–ATP synthase supercomplexes

Genetic Interactions and Mutational Analysis

Mutational analysis of FCJ1 has provided insights into its function in determining mitochondrial architecture and maintaining cristae and CJ structure . The C-terminal domain of FCJ1 is essential for its genetic interaction with the F1FO ATP synthase, underscoring its importance for FCJ1 function .

StrainRelative number of CJs per mitochondrial section (%)
Δfcj1/Fcj1 DLD1-TM68
Δfcj1/Fcj1 G52L124
Δfcj1/Fcj1 Cyt b246
Δfcj1/Fcj1 Δ166-342His4
Δfcj1/Fcj1 1-4729

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC60; SNOG_01086; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-621
Protein Length
Full Length of Mature Protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
MIC60
Target Protein Sequence
ADNKNLGETAVPNPAPTVTPSSTEKATIPSSDIPKPPPAPETAGASRSAPTIQPATTPPT GPGSASIAPDPKQPKPKKKGRIRRLLFWLTILSGLGYAGGVWYSLVSDNFHDFFTEYVPY GEDAVAYFEEREFRKRVPWPCWDSPRLQPQNLVRRTSSSILRPQWAEWRVLPTRATATSG TKGPHTIANVQEKKQEAAQTATVVKEEAAAPAPAKPVNHLDHLAVPDANDAVVQDVVKIV NDIITVINADSAHDGKYNSALDKAKSELGRVVSDINLMKANLRKESEEKVKSAHDEFEQA AKELVQRLDHQMQAQEAHWKEEFENERERLSQTYKDRLRSELEAAEKVYEQKTKNELLQQ SIHLQKSFTASVRERVEAERDGRLGKLNELSSSVHELEKLTAEWNSVVDANLKTQHLVVA VEAVKSALETQATPKPFVTELAALKEIAADDPVVSAAIASINPAAYQRGIPSPALLIDRF RRVAAEVRKAALLPEDAGVASHIASLAMSKVLFKKSGLAVGQDVEAVLARTEVLLEEGDL DAAAREMNGLQGWAKVLSKDWLGECRRVLEVRQALDVIATEARLNSLLVD
Uniprot No.

Target Background

Function

Recombinant Phaeosphaeria nodorum Formation of Crista Junctions protein 1 (FCJ1) is a component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex. This large protein complex, located in the inner mitochondrial membrane, plays vital roles in maintaining crista junctions, preserving inner membrane architecture, and establishing contact sites with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane. Additionally, it facilitates protein import through the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Phaeosphaeria nodorum and what disease does it cause?

Phaeosphaeria nodorum (anamorph Stagonospora nodorum) is a necrotrophic fungal pathogen that causes stagonospora nodorum blotch (SNB) on wheat, also known as leaf and glume blotch. The early symptoms appear as dark brown lesions on leaves. The pathogen can affect both leaves and spikes (glumes) of wheat plants . It produces enzymes or toxins that kill host cells to acquire nutrients, leading to expanding necrotic lesions . This disease remains a significant problem in wheat-growing regions worldwide, causing substantial yield losses estimated at $57M annually in Australia alone .

How does the reproduction system of P. nodorum function?

P. nodorum has a mixed reproduction system that includes both asexual and sexual reproduction:

  • Sexual reproduction: The fungus has two mating types. Individuals with different mating types must come into close contact for sexual reproduction, where one forms an antheridium and the other forms an ascogonium, followed by fusion of these structures. This leads to the development of a pseudothecium (fruiting body) containing ascospores, which are wind-borne and can be dispersed long distances .

  • Asexual reproduction: The fungus produces pycnidia containing asexual spores (pycnidiospores) that are primarily dispersed by rain splash .

Studies on mating type distribution and genetic structure support that sexual recombination occurs within the Swedish population of P. nodorum , contributing to genetic diversity within the pathogen population.

What is the origin and genetic diversity of P. nodorum?

Phylogenetic and population genetic analyses indicate that P. nodorum originated in the Fertile Crescent, coinciding with the origin of its host crop, wheat . Researchers sequenced 1683 bp distributed across three loci in 355 globally distributed Phaeosphaeria isolates, including 74 collected from Iran near wheat's center of origin. Nine phylogenetically distinct clades were identified, including two previously unknown species tentatively named P1 and P2 collected in Iran .

Two species, P. nodorum and P. avenaria f. sp. tritici 1 (Pat1), comprised approximately 85% of sampled isolates, making them the dominant wheat-infecting pathogens within the species complex . Approximately 4% of P. nodorum and Pat1 isolates showed evidence of hybridization, indicating some genetic exchange between closely related species .

How does genetic variation in the Tox1 promoter region affect pathogenicity in P. nodorum?

Recent research has identified a key polymorphic element in the Tox1 promoter region called PE401 (401 bp in length) that regulates Tox1 expression and consequently affects the pathogen's virulence . Tox1 is a necrotrophic effector (NE) that interacts with susceptibility genes in wheat.

Key findings include:

  • The presence of PE401 (located 267 bp upstream of the Tox1 start codon) reduces Tox1 expression by approximately 40-fold compared to isolates lacking this element .

  • Quantitative RT-PCR analysis revealed that Tox1 was not repressed in mutants carrying only a spacer sequence, suggesting that PE401's effect is sequence-specific .

  • P. nodorum isolates lacking PE401 showed higher virulence on wheat varieties containing the Snn1 susceptibility gene .

The mechanism appears to involve a repressor molecule that binds to PE401 and inhibits Tox1 transcription . This discovery provides insight into a "NE arms race" occurring within the P. nodorum population, where differential expression of effector genes influences pathogen fitness on different wheat genotypes.

How do necrotrophic effectors in P. nodorum interact epistatically to affect wheat infection?

Research has revealed complex epistatic interactions between different necrotrophic effectors in P. nodorum:

EffectorTarget in wheatEffect without PE401Effect with PE401
Tox1Snn1 (Chr 1B)47.9% contribution to SNB30.1% contribution to SNB
Tox2AQsnb.cur–2AS1Not detected12.1% contribution to SNB
Tox3Snn3B1Not detected in the experimentNot detected in the experiment

The presence of PE401 affects these interactions in significant ways:

  • Tox1 repression by PE401 alleviates the epistatic effect on Tox2A-Qsnb.cur–2AS1 interaction but not on Tox3-Snn3B1 .

  • In competition assays, higher Tox1-expressing strains (without PE401) rescued the reduced virulence of lower Tox1-expressing strains (with PE401) on Snn1 wheat varieties .

These findings demonstrate that Tox1 exhibits both "selfish" and "altruistic" characteristics within a mixed infection, offering insight into the complex dynamics of host-pathogen interactions in this system .

What methodologies are most effective for studying population structure and genetic diversity in P. nodorum?

Several complementary approaches have proven effective for studying P. nodorum populations:

  • Molecular markers: Studies have utilized restriction fragment length polymorphism (RFLP) probes and simple sequence repeat (SSR) markers to assess genetic variability within P. nodorum populations .

  • Multi-locus sequence typing: Sequencing multiple loci (1683 bp across three loci in one study) allowed researchers to identify distinct phylogenetic clades and determine relationships between species .

  • Diagnostic PCR-RFLP assays: Researchers developed a PCR-RFLP assay to distinguish P. nodorum from Pat1, facilitating rapid identification of these closely related pathogens .

  • Measures of private allelic richness: These analyses at SSR and sequence loci helped identify the center of origin of P. nodorum in the Fertile Crescent .

  • Coalescent analysis: This approach helped establish evolutionary relationships between P. nodorum and sister species P1 and P2 .

For comprehensive population studies, sampling should include isolates from diverse geographical regions, particularly including the center of origin (Iran/Fertile Crescent) where genetic diversity is highest .

What is FCJ1 and what is its role in mitochondrial structure?

Formation of crista junctions protein 1 (FCJ1) is a mitochondrial membrane protein in yeast that is specifically enriched in crista junctions (CJs) . CJs are tubular invaginations of the inner mitochondrial membrane that connect the inner boundary membrane with the cristae membrane . These architectural elements are critical for mitochondrial function.

FCJ1 is essential for the formation of CJs, as cells lacking FCJ1:

  • Lack CJs

  • Exhibit concentric stacks of inner membrane in the mitochondrial matrix

  • Show increased levels of F₁F₀-ATP synthase supercomplexes

In mammalian cells, the orthologue of FCJ1 is called mitofilin or IMMT (inner membrane mitochondrial protein) .

How does manipulation of FCJ1 expression affect mitochondrial structure?

Changes in FCJ1 expression lead to significant alterations in mitochondrial structure:

Overexpression of FCJ1:

  • Increases CJ formation (two- to threefold more CJs per cell compared to control cells)

  • Promotes branching of cristae (approximately 17-fold increase in cristae branching)

  • Enlarges CJ diameter and increases its variation

  • Reduces levels of F₁F₀-ATP synthase supercomplexes

Down-regulation of FCJ1:

  • Leads to progressive decrease in the number of CJs

  • Reduces cristae branching

  • Eventually results in mitochondria with continuous concentric stacks of inner membrane (similar to complete knockout phenotype)

These findings demonstrate that FCJ1 is directly involved in CJ formation and modulates the architecture of the mitochondrial inner membrane.

What protein complexes is FCJ1 associated with?

FCJ1 is part of a large multisubunit complex called MICOS (mitochondrial contact site and cristae organizing system), also known as MINOS (mitochondrial inner membrane organizing system) or MitOS . This complex plays a central role in:

  • Formation of CJs

  • Determining cristae morphology

  • Creating contact sites between the inner and outer mitochondrial membranes

FCJ1 interacts with several proteins, including:

  • Outer membrane proteins such as Tom40

  • The TOB/SAM complex (translocase of outer membrane β-barrel proteins/sorting and assembly machinery)

  • Other components of the MICOS/MINOS/MitOS complex

  • Full-length FCJ1 itself, suggesting a role in oligomer formation

These interactions are critical for stabilizing CJs at particular locations and creating contact sites between the inner and outer mitochondrial membranes.

What is the functional significance of the C-terminal domain of FCJ1?

The C-terminal domain of FCJ1 is the most conserved part of the protein and is essential for its function . Research has shown that:

  • CJ formation: In the absence of this domain, formation of CJs is strongly impaired, resulting in irregular cristae structure with stacked cristae present .

  • Protein interactions: The C-terminal domain:

    • Interacts with full-length FCJ1, suggesting a role in oligomer formation

    • Interacts with Tob55 of the TOB/SAM complex, which is required for the insertion of β-barrel proteins into the outer membrane

  • Contact site stabilization: The interaction between the C-terminal domain of FCJ1 and the TOB/SAM complex appears to stabilize CJs in close proximity to the outer membrane .

When this domain is deleted, the FCJ1-TOB interaction is suspended, which is sufficient to impair CJ formation and cristae morphology, highlighting the functional importance of this domain in determining the architecture of cristae .

How do FCJ1 and F₁F₀-ATP synthase subunits interact to regulate cristae morphology?

FCJ1 and subunits e/g of the F₁F₀-ATP synthase work in an antagonistic manner to modulate CJ formation and cristae structure:

  • F₁F₀-ATP synthase oligomerization: Cristae structure depends on the oligomerization state of the F₁F₀-ATP synthase, which is influenced by FCJ1 and subunits e and g .

  • Opposing effects:

    • FCJ1 overexpression reduces levels of F₁F₀-ATP synthase supercomplexes

    • Absence of FCJ1 increases levels of F₁F₀-ATP synthase supercomplexes

    • Deletion of subunits e/g of F₁F₀-ATP synthase causes:

      • CJ diameter enlargement

      • Reduction of cristae tip numbers

      • Promotion of cristae branching

  • Genetic interaction: FCJ1 and subunits e/g genetically interact, suggesting a coordinated mechanism for regulating cristae morphology .

This antagonistic relationship between FCJ1 and F₁F₀-ATP synthase subunits provides a mechanism for fine-tuning cristae architecture and CJ formation in response to cellular needs.

What methodological approaches are most effective for studying FCJ1 function and CJ formation?

Several complementary approaches have proven valuable for investigating FCJ1 function and CJ formation:

  • Genetic manipulation:

    • Gene knockout studies to eliminate FCJ1 expression

    • Overexpression systems with doxycycline-repressible promoters

    • Down-regulation experiments to progressively decrease FCJ1 levels

    • Domain deletion studies to investigate specific protein regions

  • Electron microscopy:

    • Transmission electron microscopy to visualize cristae morphology and CJs

    • Hyperosmotic treatment of isolated mitochondria to visualize contact sites

  • Biochemical approaches:

    • Protein interaction studies to identify binding partners

    • Analysis of F₁F₀-ATP synthase supercomplex formation

  • Functional assays:

    • Assessment of β-barrel protein biogenesis

    • Analysis of protein import into mitochondrial compartments

For comprehensive studies, combining these approaches provides the most robust understanding of FCJ1 function and CJ formation mechanisms.

What is the relationship between the TOB/SAM complex and CJ formation?

The TOB/SAM complex plays an important role in CJ formation and cristae morphology:

  • Association with contact sites: The association of the TOB/SAM complex with contact sites depends on the presence of FCJ1 .

  • Effect on cristae morphology: Depletion of the TOB/SAM complex leads to:

    • Altered cristae morphology

    • Moderate reduction in the number of CJs

  • β-barrel protein biogenesis: Although the TOB/SAM complex is required for the insertion of β-barrel proteins into the outer membrane, the biogenesis of β-barrel proteins is not significantly affected in the absence of FCJ1 .

  • Functional model: The C-terminal domain of FCJ1 interacts with the TOB/SAM complex, thereby stabilizing CJs in close proximity to the outer membrane. This interaction creates contact sites between the inner and outer mitochondrial membranes .

This relationship assigns novel functions to both the C-terminal domain of FCJ1 and the TOB/SAM complex in maintaining mitochondrial architecture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.