Recombinant Phaeosphaeria nodorum Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Description

Primary Structure

TPC1 is a 321-amino acid protein (1–321aa) encoded by the gene SNOG_04593 (UniProt accession: Q0UUH1). Key structural features include:

  • N-terminal His-tag: Facilitates purification via nickel affinity chromatography .

  • Mitochondrial localization: Ensures targeting to the inner mitochondrial membrane .

  • Transport domains: Contains conserved motifs for nucleotide recognition and translocation .

ParameterValue/DescriptionSource
Amino acid sequence (partial)MSEGVAQLKHEGSRQQVVVAGAAAGLVSRFVIAPLDVIKIRLQLQIHSLSEPTSYRGLNG PVYKGTLGTLKQILRDEGVTGLWKGNIPAELLYLTYGSVQFSAYTNISQmLDTIPAPYTL PSSANSFISGAGAGAAATTVTYPLDLLRTRFAAQGKDRVYTSIVASLKSIAQHEGPTGFF RGLGAGVSQIVPYMGLFFASYESLKPVMADSPLPLPLGSSDAVAGVVASVVSKTAVYPLD TTRKRLQVQGPNRARYVHRNIPTYSGVLMTLQHIWKHEGRRGMYRGLTVSLLKAAPASAV TMWTYERAMGIMVAFEKDGME
Gene designationSNOG_04593
Molecular weight~36 kDa (estimated)

Functional Role

TPC1 mediates the exchange of TPP (a critical cofactor for enzymatic reactions) with ATP/ADP, ensuring mitochondrial energy metabolism . Functional studies in Drosophila melanogaster and Saccharomyces cerevisiae demonstrate its ability to restore growth defects in TPP-deficient mutants, highlighting its conserved biochemical role .

Production and Purification Methods

Recombinant TPC1 is produced via heterologous expression systems, with optimization for yield and purity:

ParameterDetailsSource
Expression hostsE. coli, Yeast, Baculovirus, Mammalian cells
Purity≥85% (SDS-PAGE analysis)
Storage conditionsTris-based buffer + 50% glycerol, -20°C

Key steps:

  1. Cloning: Full-length TPC1 coding sequence is inserted into expression vectors.

  2. Expression: Induced in E. coli or yeast under optimized conditions.

  3. Purification: His-tagged protein is purified via nickel affinity chromatography, followed by buffer exchange .

Biochemical Properties

  • Transport specificity: Recombinant TPC1 exhibits affinity for TPP, pyrophosphate (PPi), ATP, ADP, and other nucleotides .

  • Kinetics: Reconstituted in liposomes, TPC1 demonstrates concentration-dependent transport activity, with a preference for TPP/ATP exchange .

SubstrateRelative Transport ActivitySource
Thiamine pyrophosphate100% (reference)
Pyrophosphate (PPi)~50%
ATP~30%

Experimental Applications

  • Functional studies: Used to investigate mitochondrial TPP import and its role in fungal metabolism .

  • Antifungal research: Potential target for disrupting fungal bioenergetics in pathogens like P. nodorum .

  • ELISA assays: Recombinant TPC1 serves as a standard in immunological studies (e.g., antibody development) .

Comparative Analysis with Homologs

OrganismTPC1 Homolog Gene IDKey DifferencesSource
Phaeosphaeria nodorumSNOG_04593Full-length (1–321aa), His-tagged
Saccharomyces cerevisiaeTPC1Partial sequence, cell-free expression
Neurospora crassaN/AFunctional homologs in tip elongation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimations, please consult your local distributors.
Note: All proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TPC1; SNOG_04593; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
TPC1
Target Protein Sequence
MSEGVAQLKHEGSRQQVVVAGAAAGLVSRFVIAPLDVIKIRLQLQIHSLSEPTSYRGLNG PVYKGTLGTLKQILRDEGVTGLWKGNIPAELLYLTYGSVQFSAYTNISQMLDTIPAPYTL PSSANSFISGAGAGAAATTVTYPLDLLRTRFAAQGKDRVYTSIVASLKSIAQHEGPTGFF RGLGAGVSQIVPYMGLFFASYESLKPVMADSPLPLPLGSSDAVAGVVASVVSKTAVYPLD TTRKRLQVQGPNRARYVHRNIPTYSGVLMTLQHIWKHEGRRGMYRGLTVSLLKAAPASAV TMWTYERAMGIMVAFEKDGME
Uniprot No.

Target Background

Function
This mitochondrial transporter facilitates the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How should recombinant TPC1 be stored and reconstituted for optimal stability?

For optimal stability, recombinant TPC1 should be stored at -20°C to -80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. Prior to opening, briefly centrifuge the vial to bring contents to the bottom.

For reconstitution:

  • Dissolve the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

This approach ensures maximum protein stability while maintaining native conformation and activity for experimental applications.

How can researchers verify the purity and integrity of recombinant TPC1?

To verify the purity and integrity of recombinant TPC1, researchers should employ multiple complementary techniques:

  • SDS-PAGE analysis: Run the protein on a polyacrylamide gel to confirm both purity (should be >90%) and the correct molecular weight

  • Western blot analysis: Use anti-His tag antibodies to confirm the presence of the N-terminal His tag

  • Mass spectrometry: Perform peptide mass fingerprinting to verify the amino acid sequence

  • Size exclusion chromatography: Ensure the protein exists in the expected oligomeric state

  • Functional assays: Test the protein's ability to bind thiamine pyrophosphate using isothermal titration calorimetry or similar techniques

For quantification purposes, protein concentration can be determined using the Bradford or BCA protein assay, with BSA as a standard. Additionally, spectrophotometric measurement at A280 using the protein's extinction coefficient provides accurate concentration determination .

What experimental design approaches are most effective for studying TPC1 function?

When designing experiments to study TPC1 function, researchers should consider a systematic approach that includes both in vitro and in vivo methods:

In vitro functional studies:

  • Reconstitution into liposomes: Incorporate purified TPC1 into artificial membrane systems to directly measure transport activity

  • Binding assays: Use isothermal titration calorimetry or surface plasmon resonance to measure binding kinetics with thiamine pyrophosphate

  • Structure-function analysis: Employ site-directed mutagenesis to identify critical residues for transport function

In vivo approaches:

  • Gene knockout/knockdown: Create TPC1-deficient P. nodorum strains using CRISPR-Cas9 or RNAi

  • Complementation studies: Reintroduce wild-type or mutant TPC1 into knockout strains

  • Localization studies: Use fluorescent protein tagging to confirm mitochondrial localization

  • Physiological assays: Measure growth, metabolism, and pathogenicity

For robust experimental design, apply the principles outlined in controlled experimental research. This includes randomization, appropriate controls, and minimization of confounding variables . For example, when testing TPC1 knockout effects on pathogenicity, ensure that both control and experimental groups are exposed to identical conditions regarding temperature, humidity, and plant host genotype.

How can researchers perform comprehensive structure-function analysis of TPC1?

A comprehensive structure-function analysis of TPC1 requires a multi-faceted approach:

  • Computational structure prediction:

    • Use homology modeling based on known mitochondrial carrier protein structures

    • Apply molecular dynamics simulations to predict conformational changes during transport

  • Experimental structure determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for high-resolution structural data

    • NMR for specific domain analysis

  • Systematic mutagenesis:

    • Alanine scanning of transmembrane regions

    • Targeted mutations of conserved residues

    • Creation of chimeric proteins with other carrier proteins

  • Functional correlation:

    • Transport assays using reconstituted proteoliposomes with different mutants

    • Binding studies to measure substrate affinity changes

    • Physiological assays in P. nodorum to connect structure to biological function

This integrated approach allows researchers to map functional domains and critical residues while understanding how structural changes impact transport activity. When implementing such studies, employ a factorial experimental design to efficiently test multiple variables and their interactions .

What are the optimal expression systems for producing functional recombinant TPC1?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant TPC1. Based on the available information and protein characteristics, several systems can be considered:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coli- High yield
- Established protocols
- Cost-effective
- Rapid expression
- Potential misfolding
- Lack of eukaryotic PTMs
- Inclusion body formation
- BL21(DE3) strain
- Induction: 0.5mM IPTG
- Expression at 18°C overnight
Yeast (P. pastoris)- Eukaryotic folding
- High-density cultures
- Secretion possible
- Longer development time
- Hyperglycosylation
- Methanol induction
- Expression at 28°C
- pH 6.0
Insect cells- Proper folding
- Higher-order PTMs
- Membrane protein expertise
- Higher cost
- Technical complexity
- Lower yield
- Sf9 or Hi5 cells
- Baculovirus system
- Expression at 27°C
Cell-free- Rapid production
- Membrane mimetics
- Direct functional analysis
- Scale limitations
- Higher cost
- E. coli extract
- Supplemented with lipids

How should researchers interpret TPC1 expression patterns in P. nodorum during host infection?

When analyzing TPC1 expression patterns during host infection, researchers should employ a systematic data interpretation framework:

  • Temporal expression analysis:

    • Establish a baseline expression in axenic culture

    • Measure expression at multiple infection stages (germination, penetration, colonization, sporulation)

    • Correlate expression changes with specific infection events

    • Compare with other mitochondrial carrier proteins to identify infection-specific patterns

  • Spatial expression analysis:

    • Use fluorescent protein fusions to visualize subcellular localization

    • Employ laser capture microdissection to isolate fungal structures from infected tissue

    • Compare expression in different fungal structures during infection

  • Comparative analysis:

    • Examine expression in compatible vs. incompatible host interactions

    • Compare with expression patterns of known virulence factors

    • Analyze in different P. nodorum isolates with varying virulence

When interpreting data, it's crucial to distinguish between correlation and causation. Changes in TPC1 expression during infection could directly impact pathogenicity or may simply reflect altered metabolic demands during different infection phases. Validation through functional studies (e.g., knockout/complementation) is essential to establish causality.

The evolutionary context is also important—research has shown that P. nodorum is part of a species complex sharing its center of origin with wheat, and interspecific hybridization has contributed to effector transmission between species . This evolutionary history should inform interpretation of expression data.

What statistical approaches are appropriate for analyzing TPC1 functional data?

Appropriate statistical analysis of TPC1 functional data depends on the experimental design and data characteristics. Here are recommended approaches for different experimental scenarios:

  • For transport activity assays:

    • Measure initial rates under varying substrate concentrations

    • Fit data to Michaelis-Menten kinetics to determine Km and Vmax

    • Use non-linear regression analysis

    • Analyze substrate specificity using competitive inhibition models

  • For gene expression studies:

    • Normalize using appropriate reference genes (validated for stability during infection)

    • Apply 2^-ΔΔCt method for relative quantification

    • Use ANOVA with post-hoc tests for multi-condition comparisons

    • Consider time-course expression with repeated measures ANOVA

  • For phenotypic analysis of mutants:

    • Use t-tests for simple two-group comparisons

    • Apply ANOVA for multi-group comparisons with appropriate post-hoc tests

    • Consider non-parametric alternatives if normality assumptions are violated

    • For virulence assays, analyze area under the disease progress curve (AUDPC)

  • For structure-function correlation:

    • Use multiple regression to correlate structural changes with functional outcomes

    • Apply principal component analysis to identify patterns in mutagenesis data

    • Consider machine learning approaches for complex datasets

In all cases, ensure proper experimental design with adequate replication (minimum n=3, preferably n≥5), appropriate controls, and randomization to minimize bias . Clearly define the null and alternative hypotheses before conducting experiments, and use power analysis to determine required sample sizes.

How can researchers address data inconsistencies in TPC1 localization studies?

Data inconsistencies in protein localization studies are common and can arise from multiple sources. To address inconsistencies in TPC1 localization studies, researchers should implement a systematic troubleshooting approach:

  • Verify tag interference:

    • Test both N- and C-terminal tags to ensure they don't disrupt targeting signals

    • Create internal tags at permissive sites if terminal tags affect localization

    • Confirm functionality of tagged protein through complementation assays

  • Validate antibody specificity:

    • Perform Western blot analysis to confirm antibody specificity

    • Include knockout controls in immunolocalization experiments

    • Consider epitope mapping to identify potential cross-reactivity

  • Employ complementary techniques:

    • Combine fluorescent protein tagging with immunogold electron microscopy

    • Use subcellular fractionation and Western blotting as biochemical validation

    • Confirm mitochondrial localization with co-localization studies using established mitochondrial markers

  • Consider dynamic localization:

    • Examine localization under different conditions (growth phase, stress, infection)

    • Perform time-lapse imaging to capture dynamic changes

    • Investigate potential dual localization patterns

  • Technical optimization:

    • Standardize fixation and permeabilization protocols

    • Optimize image acquisition parameters

    • Use deconvolution or super-resolution microscopy for improved resolution

When publishing results with inconsistencies, transparently report all methods, conditions, and observations. Consider that TPC1, as a mitochondrial carrier protein, may show primary mitochondrial localization but could potentially have additional locations or dynamically relocalize under specific conditions.

How does TPC1 interact with other components of P. nodorum's virulence machinery?

Understanding TPC1's role in P. nodorum virulence requires investigating its interactions with other virulence-associated systems:

  • Metabolic integration:

    • As a thiamine pyrophosphate carrier, TPC1 likely influences the activity of thiamine-dependent enzymes (pyruvate dehydrogenase, transketolase, α-ketoglutarate dehydrogenase)

    • These enzymes are critical for primary metabolism and potentially for the production of virulence-associated secondary metabolites

    • Investigate metabolic flux changes in TPC1 mutants using 13C-labeled substrates

  • Necrotrophic effector connections:

    • P. nodorum produces known necrotrophic effectors (NEs) that interact with wheat susceptibility genes

    • Examine whether TPC1 function affects the production or secretion of these effectors

    • Test for correlations between TPC1 expression/activity and effector production

  • Stress response coordination:

    • During infection, pathogens encounter various host defenses

    • Investigate whether TPC1 contributes to stress tolerance through metabolic adjustments

    • Analyze TPC1 expression/function under oxidative stress, nutrient limitation, and other infection-relevant stresses

  • Signaling pathway integration:

    • Examine potential connections between TPC1 and established virulence signaling pathways (MAPK, cAMP-PKA)

    • Test whether TPC1 activity is regulated by these pathways

    • Investigate whether TPC1 dysfunction alters signaling outputs

Research has demonstrated the evolutionary dynamics of P. nodorum effectors, with evidence of interspecific hybridization contributing to effector transmission . This evolutionary context provides valuable insights for understanding potential interactions between TPC1 and other virulence factors.

What approaches can researchers use to investigate TPC1's role in fungal-plant interactions?

Investigating TPC1's role in fungal-plant interactions requires a multi-faceted approach combining molecular genetics, biochemistry, and plant pathology techniques:

  • Genetic manipulation strategies:

    • Generate TPC1 knockout mutants using CRISPR-Cas9 or homologous recombination

    • Create conditional expression strains (inducible promoters)

    • Develop point mutants with altered transport properties but maintained protein stability

    • Engineer strains with fluorescently tagged TPC1 for in planta visualization

  • Pathogenicity assays:

    • Perform detached leaf assays with TPC1 mutants vs. wild-type

    • Quantify infection progression using digital image analysis

    • Measure multiple virulence parameters (lesion size, sporulation capacity, penetration efficiency)

    • Test interactions with different wheat cultivars to identify potential genotype-specific effects

  • Metabolomic approaches:

    • Compare metabolite profiles between wild-type and TPC1 mutants during infection

    • Identify key metabolic changes associated with altered TPC1 function

    • Focus on thiamine-dependent pathways and their downstream products

    • Investigate both fungal and plant metabolites to capture interaction dynamics

  • Transcriptomic analysis:

    • Perform RNA-seq on both fungal and plant tissues during infection

    • Compare expression profiles between wild-type and TPC1 mutant infections

    • Identify differentially regulated pathways in both organisms

    • Validate key findings with RT-qPCR and functional studies

When designing these experiments, ensure proper controls and replication, with careful attention to experimental variables that could confound results . Consider that P. nodorum exists within a species complex with a shared evolutionary history with wheat , which may inform the interpretation of host-pathogen interaction data.

How can researchers exploit TPC1 structure and function for developing novel fungicides?

Exploiting TPC1 as a target for novel fungicides requires a comprehensive understanding of its structure, function, and biological importance. The following research strategy could lead to targeted fungicide development:

  • Target validation:

    • Confirm essentiality or significant virulence contribution of TPC1 through gene knockout/knockdown

    • Determine if TPC1 function can be partially inhibited to reduce virulence without complete lethality

    • Assess conservation and function of TPC1 across multiple fungal pathogens to estimate spectrum of activity

  • Structure-based drug design:

    • Obtain high-resolution structure through X-ray crystallography or cryo-EM

    • Identify unique binding pockets that differ from host (wheat) mitochondrial carriers

    • Perform virtual screening of compound libraries against these unique sites

    • Use molecular dynamics simulations to understand binding site flexibility

  • High-throughput screening approaches:

    • Develop a functional assay suitable for high-throughput format (liposome-based transport assays)

    • Screen compound libraries for inhibitors of TPC1 transport activity

    • Establish secondary screens to confirm target engagement

  • Lead optimization strategy:

    StageApproachKey Parameters
    Initial hitsIn vitro transport inhibitionIC50 < 10 μM
    Lead compoundsCellular activity assessmentEC50 < 1 μM
    Lead optimizationStructure-activity relationshipImproved potency, selectivity
    Candidate selectionIn planta efficacy testing>80% disease reduction
    DevelopmentFormulation and field testingStability, application methods
  • Resistance management considerations:

    • Assess the frequency of natural polymorphisms in TPC1 across P. nodorum populations

    • Generate resistance mutants in laboratory settings to identify potential resistance mechanisms

    • Design inhibitors targeting highly conserved regions to minimize resistance development

    • Consider dual-targeting approaches to reduce resistance risk

This research pathway maximizes the potential of TPC1 as a novel fungicide target while addressing key considerations for agricultural application. The approach leverages TPC1's role in mitochondrial function, which is critical for fungal energy metabolism and virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.