Recombinant Phaeosphaeria nodorum NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MCR1; SNOG_11449; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
MCR1
Target Protein Sequence
MFARQVIRPARQLQQHVRRYASEAPQSGGSSNGALYVGIGAAGLAGAYIYMRGGKPAAPL SEEANKVAAKVGGASKKAFTGGDQGFISLLLDKSEVVNHNTKKLTFKLPEPDMESGLPVT SAVITKYKGPEMEKPVIRPYTPVSDVDQQGTVDFIVKKYEKGPMSSHMHNMEPGQRLDIK GPIPKYPWSPNKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLVFGNISEEDILLK KEWEHLENTYPQRFRAFYVLDNPPESWQGGKGFITKELLKTVLPEPKEGEKVKIFVCGPP GMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF
Uniprot No.

Target Background

Function

May mediate the reduction of outer membrane cytochrome b5.

Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Phaeosphaeria nodorum NADH-cytochrome b5 reductase 2 (MCR1) and what is its significance in fungal metabolism?

MCR1 is a flavoprotein enzyme from the fungal wheat pathogen Phaeosphaeria nodorum (also known as Parastagonospora nodorum or Stagonospora nodorum). Like other cytochrome b5 reductases, MCR1 likely catalyzes one-electron reduction reactions with various redox partners in fungal cells. Cytochrome b5 reductase is a pleiotropic flavoprotein involved in multiple reduction reactions within cellular systems . In fungal pathogens like P. nodorum, these enzymes likely contribute to redox homeostasis and may play roles in virulence mechanisms through modulation of reactive oxygen species (ROS).

The enzyme's significance lies in its potential involvement in the pathogen's ability to overcome host defense mechanisms. P. nodorum is a major fungal pathogen of wheat (Triticum aestivum), causing Septoria nodorum blotch, a significant disease affecting wheat production worldwide . Understanding MCR1's role provides insights into fundamental aspects of fungal metabolism and host-pathogen interactions.

How does MCR1 activity relate to reactive oxygen species (ROS) production in fungal-plant interactions?

MCR1, as a cytochrome b5 reductase, likely participates in NADH-dependent production of superoxide anion, a reactive oxygen species. Studies on purified cytochrome b5 reductase have demonstrated that this enzyme can catalyze NADH-dependent production of superoxide anion, with basic kinetic parameters of Vmax = 3.0 ± 0.5 μmol/min/mg and KM(NADH) = 2.8 ± 0.3 μM NADH at 37°C .

In the context of plant-pathogen interactions, ROS play a central role in plant immune responses. Research shows that necrotrophic effectors (NEs) from P. nodorum, such as SnToxA, SnTox1, and SnTox3, affect the redox status in wheat and cause necrosis and/or chlorosis in plants possessing dominant susceptibility genes . The interactions between these effectors and host genes (Tsn1–SnToxA, Snn1–SnTox1, and Snn3–SnTox3) have been shown to inhibit ROS production at the initial stage of infection, affecting various ROS-generating and ROS-scavenging enzymes including NADPH-oxidases, peroxidases, superoxide dismutase, and catalase .

MCR1 may play a role in this complex redox interplay during infection, potentially contributing to the pathogen's ability to manipulate host ROS defenses.

What are the structural and functional characteristics of MCR1 compared to other cytochrome b5 reductases?

While specific structural information about P. nodorum MCR1 is limited in the available research, cytochrome b5 reductases typically share several common features:

Structural Features:

  • Contain FAD as a prosthetic group essential for electron transfer

  • Comprise an FAD-binding domain and an NADH-binding domain

  • Include conserved catalytic residues involved in electron transfer

Functional Properties:

  • Catalyze the reduction of cytochrome b5 using NADH as an electron donor

  • Can generate superoxide anion in an NADH-dependent manner

  • May be susceptible to inhibition by compounds like apocynin, which appears to affect the NADH binding site

  • Can be regulated by reactive nitrogen species, with evidence suggesting that nitric oxide-induced nitrosylation and peroxynitrite-induced tyrosine nitration/cysteine oxidation can modify the conformation of the NADH binding domain

Kinetic Parameters (based on similar enzymes):

  • KM for NADH typically in the low micromolar range (approximately 2.8 μM)

  • Activity often optimal at physiological pH and temperature

MCR1 from P. nodorum likely shares these general characteristics but may possess unique features related to its specific role in this fungal pathogen's lifecycle and virulence mechanisms.

What are the optimal conditions for expressing and purifying recombinant MCR1?

Based on approaches used for similar flavoproteins and cytochrome b5 reductases, the following protocol is recommended:

Expression System Selection:

  • Escherichia coli BL21(DE3) or Rosetta strains for basic studies

  • Consideration of codon optimization for fungal genes

  • Temperature control during expression (16-20°C recommended for flavoproteins)

  • IPTG concentration typically 0.1-0.5 mM to avoid inclusion body formation

Buffer Composition for Purification:

  • Lysis buffer: 50 mM sodium phosphate pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT

  • Addition of FAD (5-10 μM) to purification buffers to maintain cofactor association

  • Inclusion of protease inhibitor cocktail to prevent degradation

Purification Strategy:

  • Affinity chromatography (Ni-NTA for His-tagged protein)

  • Ion exchange chromatography (typically anion exchange)

  • Size exclusion chromatography as final polishing step

  • Quality assessment via SDS-PAGE, spectroscopic analysis of FAD content

Critical Considerations:

  • Protection from light during purification to prevent flavin degradation

  • Maintenance of reducing conditions to prevent oxidative damage

  • Temperature control throughout the purification process

  • Storage in buffer containing glycerol (20-25%) at -80°C for long-term stability

What methods are most reliable for measuring MCR1 enzymatic activity?

Several complementary approaches are recommended for comprehensive assessment of MCR1 activity:

NADH Oxidation Assay:

  • Spectrophotometric monitoring of NADH oxidation at 340 nm

  • Reaction mixture containing purified MCR1 (0.1-1 μg/ml), NADH (10-100 μM), and appropriate buffer (pH 7.0-7.5)

  • Calculation of activity using the extinction coefficient of NADH (ε340 = 6,220 M−1cm−1)

Superoxide Anion Detection Assays:

  • Cytochrome c reduction assay:

    • Monitoring absorbance increase at 550 nm

    • Inclusion of superoxide dismutase (SOD) as a control

    • Calculation using extinction coefficient: ε550 = 21,000 M−1cm−1

  • Nitroblue tetrazolium (NBT) reduction:

    • Measurement of formazan formation at 560 nm

    • Direct visualization in gel activity assays

    • Quantification using standard curves

Data Analysis Parameters:

  • Linear range determination for enzyme concentration

  • Determination of kinetic parameters (KM, Vmax) through Michaelis-Menten analysis

  • Temperature and pH optima characterization

  • Stability assessment under various storage conditions

Based on studies of similar enzymes, expected parameters might include KM(NADH) of approximately 2.8 μM and Vmax around 3.0 μmol/min/mg at 37°C .

How can researchers investigate the inhibition profile of MCR1?

A comprehensive inhibition study should include:

Experimental Design:

  • Concentration-response curves with varying inhibitor concentrations

  • Pre-incubation studies to identify time-dependent inhibition

  • Substrate concentration variation to determine inhibition type

  • Analysis across different pH and temperature conditions to assess condition-dependent effects

Key Inhibitors to Test:

  • Apocynin, which has been shown to inhibit cytochrome b5 reductase by increasing KM(NADH)

  • Reactive nitrogen species like nitric oxide donors and peroxynitrite, which have been shown to inhibit cytochrome b5 reductase through modification of cysteines and tyrosines

  • Classical flavoenzyme inhibitors (diphenyleneiodonium, phenylhydrazine)

  • Metal chelators to assess metal ion dependency

Analysis Methods:

  • Lineweaver-Burk plots for inhibition type determination

  • Dixon plots for Ki calculation

  • IC50 determination through non-linear regression

  • Reversibility assessment through dilution or dialysis

Table 1. Reported Inhibitory Effects on Cytochrome b5 Reductase

InhibitorConcentration RangeInhibition TypeProposed MechanismReference
ApocyninPhysiological range used in cell culturesIncreases KM(NADH)Binding near/overlapping the NADH binding site
Nitric oxidePhysiological rangeDecreases NADH affinityNitrosylation of cysteines
PeroxynitritePhysiological rangeDecreases NADH affinityTyrosine nitration and cysteine oxidation

How does MCR1 potentially contribute to P. nodorum virulence mechanisms?

Understanding MCR1's role in P. nodorum virulence requires integration of several research approaches:

Potential Roles in Pathogenicity:

  • Modulation of ROS production during host colonization

  • Potential interactions with necrotrophic effectors (NEs) system

  • Contribution to redox homeostasis during infection stress

  • Possible detoxification of host-generated ROS

Research has shown that P. nodorum pathogenicity involves necrotrophic effectors (SnToxA, SnTox1, SnTox3) that interact with host susceptibility genes (Tsn1, Snn1, Snn3), leading to necrosis and chlorosis in wheat . These interactions have been demonstrated to inhibit ROS production at the initial stages of infection by affecting various enzymes involved in redox metabolism, including NADPH oxidases (TaRbohD, TaRbohF), peroxidases (TaPrx), superoxide dismutase, and catalase .

MCR1, as a cytochrome b5 reductase involved in redox reactions, may play a complementary role in this complex virulence system, potentially contributing to the pathogen's ability to manipulate host ROS responses and establish successful infection.

What approaches can be used to study MCR1's potential interactions with host plant ROS defense systems?

Several methodological approaches are recommended:

Genetic Manipulation Studies:

  • Generation of MCR1 knockout/knockdown strains using CRISPR-Cas9 or RNAi

  • Complementation with wild-type vs. catalytically inactive MCR1 variants

  • Creation of fluorescently tagged MCR1 for localization studies during infection

In Planta ROS Detection Methods:

  • 3,3'-Diaminobenzidine (DAB) staining for hydrogen peroxide

  • Nitroblue tetrazolium (NBT) staining for superoxide

  • Fluorescent probes (e.g., DCFH-DA, HyPer) for live-cell ROS imaging

  • EPR spectroscopy for precise ROS species identification

Molecular Analysis Techniques:

  • RNA-seq analysis of host and pathogen during infection

  • qRT-PCR for key ROS-related genes (TaRbohD, TaRbohF, TaPrx)

  • Proteomics to identify post-translational modifications related to oxidative stress

  • Co-immunoprecipitation to identify direct protein interactions

Biochemical Approaches:

  • Measurement of ROS-scavenging enzyme activities in infected tissues

  • Analysis of redox metabolites (glutathione, ascorbate) during infection

  • In vitro reconstitution of MCR1 with host target proteins

  • Assessment of MCR1 activity under conditions mimicking infection microenvironments

Research has shown that P. nodorum effectors can suppress host defense responses by inhibiting the transcription of salicylate signaling pathway genes (PR-1, PR-2) and WRKY transcription factors at early infection stages , suggesting potential cross-talk between fungal virulence factors and host immune responses that could involve MCR1.

How can researchers integrate MCR1 studies into broader investigations of P. nodorum pathogenicity mechanisms?

MCR1 research should be integrated with other P. nodorum pathogenicity studies through:

Systems Biology Approaches:

  • Integration of transcriptomics, proteomics, and metabolomics data

  • Network analysis to position MCR1 within virulence-associated pathways

  • Comparative analysis across multiple P. nodorum isolates with varying virulence

  • Mathematical modeling of redox dynamics during infection

Comparative Studies with Known Virulence Mechanisms:

  • Analysis of potential interactions between MCR1 and known necrotrophic effectors

  • Investigation of temporal coordination between MCR1 activity and effector production

  • Evaluation of MCR1 role in different phases of infection (penetration, colonization, sporulation)

Host Response Integration:

  • Analysis of wheat cultivars with varying susceptibility to determine if MCR1 contributions differ

  • Examination of potential interactions with host susceptibility genes (Tsn1, Snn1, Snn3)

  • Investigation of wheat ROS responses in the context of MCR1 activity

Translational Applications:

  • Development of MCR1-targeting strategies for disease management

  • Identification of wheat varieties with enhanced resistance to MCR1-mediated effects

  • Exploration of MCR1 as a target for fungicide development

What are common challenges in studying recombinant MCR1 and how can they be addressed?

Researchers may encounter several challenges when working with recombinant MCR1:

Challenge: Protein Insolubility and Inclusion Body Formation
Solutions:

  • Reduce expression temperature (16-20°C)

  • Decrease inducer concentration

  • Co-express with molecular chaperones

  • Use solubility-enhancing fusion tags (SUMO, MBP)

  • Consider refolding protocols if inclusion bodies persist

Challenge: Low FAD Incorporation and Loss of Cofactor
Solutions:

  • Supplement expression media with riboflavin

  • Add FAD to purification buffers (5-10 μM)

  • Minimize exposure to light during purification

  • Measure FAD:protein ratio spectrophotometrically

  • Consider reconstitution with FAD after purification

Challenge: Oxidative Inactivation
Solutions:

  • Include reducing agents in all buffers (1-5 mM DTT)

  • Work under nitrogen atmosphere when possible

  • Add antioxidants to storage buffers

  • Aliquot and store at -80°C to minimize freeze-thaw cycles

Challenge: Inconsistent Activity Measurements
Solutions:

  • Standardize enzyme concentration determination methods

  • Use internal controls for day-to-day normalization

  • Control temperature rigorously during assays

  • Validate activity with multiple complementary assays

  • Implement statistical process control for assay monitoring

How should researchers interpret conflicting data between in vitro MCR1 activity and in planta phenotypes?

When confronted with discrepancies between in vitro and in planta observations:

Systematic Analysis Framework:

  • Verify enzyme integrity in both contexts

  • Consider physiological conditions that might differ (pH, ion concentrations, redox status)

  • Evaluate potential post-translational modifications occurring in planta

  • Assess protein-protein interactions present in vivo but absent in vitro

  • Examine substrate availability differences between systems

Alternative Hypotheses to Consider:

  • MCR1 may have different substrate preferences in planta

  • Host factors may modulate MCR1 activity during infection

  • Temporal dynamics may be critical (early vs. late infection stages)

  • Compensatory mechanisms may mask phenotypes in deletion mutants

  • Localization differences may affect functional outcomes

Experimental Reconciliation Approaches:

  • Develop semi-in vivo assays using plant extracts

  • Implement activity assays in infected plant tissues

  • Use genetic complementation with activity-altered variants

  • Conduct correlation analyses across multiple conditions and wheat varieties

  • Perform time-resolved studies throughout infection cycle

Research has shown that P. nodorum effectors like SnToxA and SnTox3 can interact with host pathogenesis-related protein 1 (PR-1), leading to increased susceptibility . Such protein-protein interactions, which may not be apparent in simple in vitro assays, could influence MCR1 function in complex ways during actual infection.

What statistical approaches are most appropriate for analyzing complex MCR1 activity datasets?

For robust analysis of MCR1 data:

For Enzyme Kinetics Data:

  • Non-linear regression for Michaelis-Menten parameters

  • Global fitting for complex kinetic models

  • Analysis of residuals to validate model fitting

  • Bootstrap methods for confidence interval estimation

For Comparing Experimental Conditions:

  • ANOVA with appropriate post-hoc tests for multiple comparisons

  • Mixed-effects models for repeated measures designs

  • Non-parametric alternatives when normality assumptions are violated

  • Power analysis to ensure adequate sample sizes

For Multivariate Analysis:

  • Principal component analysis to identify patterns across parameters

  • Hierarchical clustering for grouping similar experimental conditions

  • Partial least squares regression for relating activity to multiple factors

  • MANOVA for examining effects on multiple dependent variables

For Time-Course Experiments:

  • Repeated measures ANOVA with time as within-subject factor

  • Area under the curve (AUC) analysis

  • Growth curve modeling for infection progression

  • Time-to-event analysis for developmental transitions

Table 2. Recommended Statistical Approaches for Different MCR1 Research Questions

Research Question TypeRecommended Statistical ApproachKey ConsiderationsSoftware Tools
Enzyme kinetics parametersNon-linear regression, Lineweaver-Burk analysisTest multiple models, validate assumptionsGraphPad Prism, R (drc package)
Inhibitor efficacy comparisonIC50 determination, ANOVAInclude positive controls, generate complete dose-response curvesGraphPad Prism, R
In planta activity correlationMixed-effects models, correlation analysisAccount for biological variability, include time as factorR (lme4), SAS
Multi-condition screeningPCA, hierarchical clusteringStandardize variables, validate clustering stabilityR (FactoMineR), Python (scikit-learn)

What emerging technologies show promise for advancing MCR1 research?

Several cutting-edge approaches are transforming MCR1 and cytochrome b5 reductase research:

Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for high-resolution structural determination

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Single-molecule FRET for analyzing enzyme conformational changes

  • Time-resolved X-ray crystallography for catalytic mechanism elucidation

Genome Editing and Synthetic Biology:

  • CRISPR-Cas9 for precise genome modification in P. nodorum

  • Base editing for single nucleotide modifications without double-strand breaks

  • Inducible expression systems for temporal control of MCR1 activity

  • Synthetic biology approaches for creating MCR1 variants with novel properties

Advanced Imaging Technologies:

  • Super-resolution microscopy for nanoscale localization in fungal cells

  • Light sheet microscopy for 3D visualization of infection dynamics

  • Correlative light and electron microscopy for ultrastructural context

  • Intravital imaging for real-time visualization of host-pathogen interactions

Systems Biology Integration:

  • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

  • Machine learning for prediction of protein-protein interactions

  • Genome-scale metabolic modeling of redox metabolism

  • Network pharmacology for identifying intervention points

How can researchers study the evolution and conservation of MCR1 across fungal pathogens?

Evolutionary studies of MCR1 can provide insights into its functional significance:

Comparative Genomics Approaches:

  • Identification of MCR1 orthologs across fungal species

  • Analysis of selection pressure using dN/dS ratios

  • Synteny analysis to examine conservation of genomic context

  • Assessment of gene duplication and diversification events

Phylogenetic Analysis Methods:

  • Maximum likelihood tree construction

  • Bayesian phylogenetic inference

  • Reconciliation of gene and species trees

  • Detection of horizontal gene transfer events

Structural Bioinformatics:

  • Homology modeling based on related cytochrome b5 reductases

  • Identification of conserved catalytic residues and structural motifs

  • Molecular dynamics simulations to assess functional implications of sequence variations

  • Prediction of protein-protein interaction interfaces

Functional Validation:

  • Heterologous expression of MCR1 orthologs from different species

  • Complementation studies in P. nodorum MCR1 knockout strains

  • Domain swapping experiments to identify functionally divergent regions

  • Site-directed mutagenesis guided by evolutionary analysis

What potential roles might MCR1 play in fungicide resistance mechanisms?

Understanding MCR1's potential involvement in fungicide resistance is crucial:

Potential Mechanisms of Involvement:

  • Direct detoxification of reactive oxygen species generated by certain fungicides

  • Contribution to general stress responses that enhance survival under fungicide exposure

  • Possible role in redox cycling of certain fungicide compounds

  • Alteration of cellular redox state affecting fungicide uptake or metabolism

Research Approaches:

  • Comparative analysis of MCR1 expression in fungicide-resistant vs. sensitive strains

  • Generation of overexpression strains to assess impact on fungicide susceptibility

  • Evaluation of MCR1 activity in the presence of different fungicide classes

  • Screening for mutations in MCR1 associated with resistance phenotypes

Practical Applications:

  • Development of MCR1 inhibitors as potential fungicide synergists

  • Use of MCR1 activity as a biomarker for certain resistance mechanisms

  • Design of resistance management strategies accounting for MCR1 contributions

  • Development of diagnostic tools for resistance prediction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.