Recombinant Phaeosphaeria nodorum Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Phaeosphaeria nodorum VMA21

Recombinant Phaeosphaeria nodorum Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) is a bioengineered version of the native fungal protein, expressed in Escherichia coli for structural and functional studies. This protein is critical for the assembly of the vacuolar ATPase (V-ATPase) complex, a proton pump essential for organelle acidification. Its recombinant form enables detailed analysis of its structure, interactions, and mechanisms in fungal and cross-species systems.

Research Applications and Findings

3.1 Structural Insights
The P. nodorum VMA21 structure was modeled using SWISS-MODEL, yielding a QMEAN score of 0.72, indicating reliable tertiary structure prediction . Key features include:

  • Transmembrane Domains: Predicted to span the ER membrane, aligning with its role in V₀ assembly.

  • Interaction Surfaces: Hypothetical binding sites for V₀ subunits (e.g., V₀c) inferred from yeast homology .

Comparative Studies

SpeciesVMA21 OrthologKey DifferencesSource
Saccharomyces cerevisiaeVma21pContains C-terminal dilysine motif for ER retention; absent in human VMA21
Homo sapiensVMA21Hypomorphic mutations cause X-linked myopathy (XMEA) and glycosylation disorders
P. nodorumVMA21 (Q0UV26)Full-length recombinant form available; fungal-specific isoforms not yet characterized

3.3 Disease Relevance
While P. nodorum VMA21 is not directly linked to human diseases, its structural and functional homology to human VMA21 provides a model for studying V-ATPase assembly defects. Human VMA21 mutations disrupt lysosomal acidification, causing autophagic myopathy and hepatic steatosis . Recombinant P. nodorum VMA21 could serve as a tool to elucidate conserved assembly mechanisms.

Technical Considerations

Production and Handling

ParameterRecommendationSource
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionUse deionized sterile water (0.1–1.0 mg/mL); add 50% glycerol for long-term storage
StabilityAvoid repeated freeze-thaw cycles

Challenges and Gaps

  • Limited Functional Data: No published studies detail P. nodorum VMA21’s interaction with fungal V-ATPase subunits.

  • Isoform Diversity: Unlike human VMA21, fungal isoforms (e.g., VMA21-101, VMA21-120) remain poorly characterized .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VMA21; SNOG_04388; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Target Names
VMA21
Target Protein Sequence
MTTRRIIGQDGEEKTYLDVDPRGPPGPSNISPAVPASVIWKLMSFTFAMITLPIGTYFFT VNYVFGGNATYAGALAAIMANVVLIAYVIMAFKDDQAEQAEDAREAKKEL
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum. This complex plays a critical role in maintaining cellular pH homeostasis and other vital functions.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is VMA21 and what is its primary function in cellular systems?

VMA21 is an assembly factor gene essential for the V0 domain of vacuolar ATPases (V-ATPases). It functions as a protein chaperone for V-ATPase assembly, particularly in the endoplasmic reticulum, and is required for proper assembly of the integral membrane sector of the V-ATPase complex . This protein plays a crucial role in maintaining lysosomal acidification, which is fundamental to normal cellular function. VMA21 is not a subunit of the purified V-ATPase complex itself but rather facilitates its assembly . Deficiency in VMA21 leads to lysosomal neutralization and impaired lysosomal function .

How is VMA21 structurally characterized?

VMA21 is an 8.5-kDa integral membrane protein that contains a distinctive dilysine motif at its carboxy terminus . This motif is critical for its retention in the endoplasmic reticulum. Mutation of these lysine residues abolishes this retention mechanism, resulting in the delivery of VMA21 to the vacuole, which is the default compartment for yeast membrane proteins . The human VMA21 protein shares approximately 70% identity at the protein level with its zebrafish counterpart, indicating a high degree of evolutionary conservation .

What experimental models are currently available for studying VMA21 function?

Several experimental models have been developed for studying VMA21:

  • Yeast models: Initial characterization of VMA21 occurred in yeast, where vma21 mutants fail to assemble the V-ATPase complex onto the vacuolar membrane .

  • Cancer cell lines: LoVo and SW620 colorectal cancer cell lines have been used to study VMA21 overexpression and its effects on cancer cell growth and colony formation .

  • Zebrafish models: CRISPR-Cas9 gene editing has been used to generate zebrafish with loss-of-function mutations in the vma21 gene. These models demonstrate impaired motor function, liver dysfunction, and dysregulated autophagy, providing insights into VMA21's role in vertebrate physiology .

What diseases are associated with VMA21 dysfunction?

VMA21 dysfunction has been associated with several pathological conditions:

  • X-linked myopathy with excessive autophagy (XMEA): Characterized by proximal muscle weakness and progressive vacuolation, this condition results from mutations in VMA21 leading to lysosomal neutralization and impaired function .

  • Colorectal cancer (CRC): VMA21 expression is upregulated in CRC compared to adjacent normal tissues. Interestingly, high VMA21 expression correlates with a favorable disease-specific survival in patients with stage I-III CRC, suggesting a potential tumor suppressor role .

What methodologies are most effective for studying VMA21 expression patterns in different tissue types?

For comprehensive analysis of VMA21 expression across tissues, a multi-modal approach is recommended:

  • Transcriptomic analysis: RNA-seq or microarray analysis can identify differential expression patterns of VMA21 across tissue types. In colorectal cancer research, TCGA-CRC cohort analysis successfully identified VMA21 as differentially expressed between cancerous and normal tissues .

  • Immunohistochemistry (IHC): This technique has proven valuable for validating mRNA findings at the protein level. For VMA21, IHC analysis confirmed cytoplasmic localization in colorectal epithelial cells and demonstrated gradually increasing expression from adjacent normal tissues to adenoma and primary CRC .

  • Western blotting: This method provides quantitative assessment of protein expression levels. In zebrafish models, western blotting confirmed decreased Vma21 protein levels in mutant models compared to wild-type and heterozygous controls .

  • Subcellular localization studies: Immunofluorescence microscopy combined with organelle-specific markers can determine VMA21's precise localization within cellular compartments, particularly in the endoplasmic reticulum where it functions .

How can researchers effectively modulate VMA21 expression for functional studies?

Several approaches have proven effective for modulating VMA21 expression:

  • Overexpression systems: Transfection of expression vectors containing VMA21 cDNA has been successfully employed in colorectal cancer cell lines (LoVo and SW620). These systems confirmed that VMA21 overexpression decreases colony formation ability in CRC cells .

  • CRISPR-Cas9 gene editing: This technique has been used to generate loss-of-function mutations in the zebrafish vma21 gene. Specific targeting of exon 2 produced two distinct mutations: a 1 bp deletion causing a frameshift without a premature stop codon, and a 14 bp deletion with a 21 bp insertion introducing a new stop codon .

  • RNA interference: While not explicitly mentioned in the search results, siRNA or shRNA approaches targeting VMA21 represent complementary methods for loss-of-function studies.

  • Animal models: For in vivo studies, both xenograft models with VMA21-overexpressing cancer cells and genetically engineered zebrafish models have provided valuable insights into VMA21 function in complex biological systems .

What are the critical considerations when designing experiments to investigate VMA21's role in lysosomal function?

When investigating VMA21's role in lysosomal function, researchers should consider:

  • Lysosomal pH measurement: Since VMA21 is critical for V-ATPase assembly and lysosomal acidification, methods to accurately measure lysosomal pH (such as LysoTracker dyes or ratiometric pH-sensitive fluorescent proteins) are essential.

  • Autophagic flux assessment: VMA21 deficiency impairs lysosomal function and disrupts autophagy. Monitoring autophagic markers (LC3-II, p62) and flux (using bafilomycin A1 or chloroquine) is crucial to understand the impact of VMA21 manipulation .

  • Electron microscopy: This technique is vital for visualizing characteristic autophagic vacuoles in tissues, especially in muscle fibers where these changes are prominent in XMEA .

  • Functional readouts: Depending on the model system, appropriate functional assessments should be included. In zebrafish, these include swim behavior and survival measurements; in cell culture, lysosomal enzyme activity assays are informative .

  • Complementation studies: Rescue experiments with wild-type VMA21 in deficient models provide strong evidence for specific VMA21 functions versus potential off-target effects.

What molecular mechanisms underlie the paradoxical tumor suppressor role of VMA21 in colorectal cancer despite its upregulation?

The apparent paradox of VMA21 upregulation in colorectal cancer while functioning as a tumor suppressor involves complex mechanisms:

  • Differential impacts on autophagy: VMA21 deficiency decreases lysosomal-mediated degradation and blocks autophagy . Since increased autophagy can inhibit tumor progression in certain contexts, VMA21's role in maintaining autophagic flux may contribute to its tumor suppressor function .

  • Tissue-specific effects: VMA21 appears to exhibit context-dependent functions across different cancer types. While it suppresses colorectal cancer growth, evidence suggests it may promote growth in ovarian and lung cancer cells . This highlights the importance of tissue-specific studies.

  • Compensatory upregulation: The elevated expression of VMA21 in CRC may represent a compensatory response to other oncogenic processes rather than a driver of carcinogenesis. This pattern has been observed with other genes like GUCY2C, which is elevated in CRC but serves as a tumor suppressor .

  • Differentiation status influence: High expression of VMA21 associates with well-differentiated CRC, suggesting its role in maintaining cellular differentiation programs that may counter malignant transformation .

What is the relationship between VMA21 and the V-ATPase complex assembly pathway?

VMA21 plays a specialized role in V-ATPase complex assembly:

  • Endoplasmic reticulum retention: VMA21 is specifically retained in the endoplasmic reticulum through its carboxy-terminal dilysine motif, positioning it to facilitate early steps of V-ATPase assembly .

  • Assembly facilitation: VMA21 is required for the assembly of the integral membrane sector (V0 domain) of the V-ATPase in the endoplasmic reticulum .

  • Protection from degradation: In vma21 mutant yeast, the 100-kDa integral membrane subunit of the V-ATPase is rapidly degraded by non-vacuolar proteases, indicating VMA21's role in stabilizing V-ATPase components during assembly .

  • Coordination with other assembly factors: VMA21 expression correlates with other V-ATPase assembly factors (ATP6AP1 and ATP6AP2), suggesting coordinated regulation of the assembly pathway .

What are the most reliable protocols for recombinant VMA21 protein expression and purification?

While the search results don't provide specific protocols for recombinant VMA21 expression, based on its properties as an integral membrane protein, the following approach is recommended:

  • Expression system selection: For small integral membrane proteins like VMA21 (8.5 kDa), bacterial expression systems (E. coli) with specialized membrane protein expression vectors are recommended. Alternatively, yeast expression systems may provide more native-like post-translational modifications.

  • Fusion tags: N-terminal His-tag or GST-tag fusion constructs facilitate purification while minimizing interference with the critical C-terminal dilysine motif.

  • Membrane extraction: Gentle detergent solubilization using non-ionic detergents (DDM, LMNG) is essential for maintaining protein structure and function.

  • Purification strategy: Affinity chromatography followed by size exclusion chromatography in detergent micelles or reconstitution into nanodiscs or liposomes for functional studies.

  • Functional validation: Given VMA21's role in V-ATPase assembly, co-purification assays with V-ATPase components can verify the recombinant protein's functionality.

How can researchers accurately assess V-ATPase assembly and function in VMA21 mutant models?

To comprehensively evaluate V-ATPase assembly and function in VMA21 mutant models:

  • Subcellular fractionation: To determine the localization of V-ATPase components in different cellular compartments, particularly for assessing failure of complex assembly on the vacuolar/lysosomal membrane .

  • Co-immunoprecipitation: To analyze protein-protein interactions between V-ATPase subunits and determine which assembly steps are disrupted in VMA21 mutants.

  • Proteolytic degradation assessment: To monitor the fate of unassembled V-ATPase components, particularly the 100-kDa integral membrane subunit that is rapidly degraded in the absence of functional VMA21 .

  • Lysosomal pH measurement: LysoTracker staining or ratiometric pH probes to quantify lysosomal acidification defects resulting from impaired V-ATPase assembly .

  • Functional consequences assessment: Analysis of autophagy markers, lysosomal enzyme activities, and organelle morphology through electron microscopy to evaluate downstream effects of V-ATPase dysfunction .

What statistical approaches are most appropriate for analyzing VMA21 expression data in patient cohorts?

For robust analysis of VMA21 expression in patient cohorts, the following statistical approaches are recommended:

  • Cut-off value determination: Optimal cut-off values for VMA21 expression can be determined using specialized software like maxstat, which identifies thresholds that most efficiently distinguish differences in clinical outcomes .

  • Survival analysis: Kaplan-Meier analysis with log-rank tests is appropriate for evaluating associations between VMA21 expression and outcomes like disease-specific survival (DSS) and disease-free survival (DFS) .

  • Multivariate Cox analysis: This approach controls for covariates (stage, lymph nodes, grade, serum markers) when assessing VMA21's independent prognostic value. In colorectal cancer studies, this approach identified VMA21 expression as independently associated with DSS (hazard ratio, 0.345; 95% confidence interval, 0.123–0.976) .

  • Subgroup analysis: Stratification by disease stage, treatment modality, or other clinical parameters can reveal context-dependent associations. For example, VMA21 expression showed marginal association with DSS in stage II CRC patients receiving chemotherapy, but not in untreated patients .

  • Correlation analysis: Pearson correlation coefficients can identify associations between VMA21 and other relevant genes. Significant correlations were observed between VMA21 and other assembly factors (ATP6AP1 and ATP6AP2) .

What therapeutic strategies targeting VMA21 or V-ATPase function show promise for treating XMEA?

Based on zebrafish model research, several therapeutic approaches show promise:

  • Antioxidant therapy: Edaravone, a free radical scavenger, improved swim behavior and survival in VMA21-deficient zebrafish, suggesting oxidative stress is a key component of XMEA pathophysiology .

  • Autophagy modulation: LY294002, a PI3K inhibitor that affects autophagy signaling, also demonstrated benefits in the zebrafish XMEA model, improving both swim behavior and survival .

  • V-ATPase assembly enhancement: Therapies designed to stabilize partially assembled V-ATPase complexes or enhance alternative assembly pathways may provide benefit, though specific agents were not identified in the search results.

  • Gene therapy approaches: Given XMEA results from loss-of-function mutations, gene replacement strategies delivering functional VMA21 could theoretically address the root cause of the disease.

How might VMA21 expression serve as a biomarker in colorectal cancer diagnosis and prognosis?

VMA21 shows significant potential as a biomarker in colorectal cancer:

  • Diagnostic applications: VMA21 protein expression increases gradually from adjacent normal tissues to adenoma to primary CRC (P trend < 0.001), suggesting utility as a diagnostic marker for early detection and disease progression .

  • Prognostic stratification: High VMA21 expression (IHC-score >215) correlates with favorable disease-specific survival in patients with stage I-III CRC, particularly in early-stage disease (stages I-II) .

  • Treatment response prediction: In patients receiving chemotherapy, VMA21 expression showed marginal association (P = 0.062) with disease-specific survival in stage II disease, suggesting potential value in identifying patients who might benefit from adjuvant therapy .

  • Integration with other markers: While the search results note that other critical prognostic factors like microsatellite instability (MSI) were not included in the studies, future research could explore combining VMA21 with established markers for improved prognostic models .

What are the most pressing unanswered questions regarding VMA21 biology?

Several critical knowledge gaps remain in VMA21 research:

  • Tissue-specific functions: The apparent contradictory roles of VMA21 in different cancer types (tumor suppressor in colorectal cancer vs. growth promoter in ovarian and lung cancer) require further investigation .

  • Regulatory mechanisms: How VMA21 expression is regulated under normal and pathological conditions remains poorly understood.

  • Protein interactions: Beyond V-ATPase assembly, the complete interactome of VMA21 and potential roles in other cellular processes need further exploration.

  • Systemic effects: While XMEA primarily affects muscle, the consequences of VMA21 dysfunction on other organ systems require additional study, as suggested by liver dysfunction in zebrafish models .

  • Therapeutic targeting: The potential of directly modulating VMA21 function as a therapeutic strategy for various diseases requires further exploration.

What novel technologies might advance our understanding of VMA21's molecular mechanisms?

Emerging technologies with potential to advance VMA21 research include:

  • Cryo-electron microscopy: This approach could reveal the detailed structural interactions between VMA21 and V-ATPase components during the assembly process.

  • Proximity labeling proteomics: BioID or APEX2-based approaches could identify novel VMA21 interacting partners in living cells within their native cellular compartments.

  • Single-cell transcriptomics and proteomics: These technologies could reveal cell-type-specific expression patterns and functions of VMA21 in heterogeneous tissues.

  • Organ-on-chip models: These systems could provide more physiologically relevant contexts for studying VMA21 function compared to traditional cell culture.

  • In vivo CRISPR screens: Systematic functional genomics approaches could identify genetic modifiers of VMA21-related phenotypes.

What are the common challenges in generating and validating VMA21 knockdown or knockout models?

Researchers working with VMA21 models should anticipate several challenges:

  • Complete knockout lethality: Complete loss-of-function mutations in VMA21 may be lethal, as suggested by clinical observations that patients typically have hypomorphic rather than null mutations . This necessitates conditional knockout approaches or careful titration of knockdown efficiency.

  • Phenotypic validation: Confirming VMA21 deficiency should include both protein expression analysis (western blotting) and functional readouts (lysosomal pH, V-ATPase assembly) .

  • Model-specific considerations: Different model systems present unique challenges. In zebrafish, two different mutations were generated (1 bp deletion causing frameshift without premature stop codon, and 14 bp deletion with 21 bp insertion introducing a new stop codon), highlighting the importance of characterizing multiple independent mutant lines .

  • Compensatory mechanisms: Long-term VMA21 deficiency may trigger compensatory upregulation of alternative pathways that mask primary phenotypes, necessitating acute inducible systems for some studies.

How can researchers resolve inconsistencies in VMA21 expression data across different experimental platforms?

To address inconsistencies in VMA21 expression data:

  • Multi-platform validation: Combine RNA-seq/microarray data with qPCR, western blotting, and immunohistochemistry to comprehensively assess expression at both mRNA and protein levels .

  • Cell type heterogeneity consideration: VMA21 expression in whole tissues may be affected by the mixture of transcripts from different cell populations. Microdissection or single-cell approaches can help resolve cell-type-specific expression patterns .

  • Antibody validation: Rigorous validation of antibody specificity through multiple approaches (knockout controls, multiple antibodies targeting different epitopes) is essential for reliable protein detection.

  • Normalization strategy standardization: Consistent use of validated housekeeping genes or proteins for normalization across studies facilitates more reliable cross-study comparisons.

  • Metadata documentation: Comprehensive documentation of experimental conditions, sample handling, and processing protocols helps identify sources of variation across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.