Recombinant Phaffia rhodozyma Bifunctional lycopene cyclase/phytoene synthase (crtYB)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

The crtYB enzyme from Phaffia rhodozyma (also known as Xanthophyllomyces dendrorhous) is a bifunctional enzyme that catalyzes two distinct reactions in the carotenoid biosynthetic pathway. It performs both phytoene synthase activity, which converts geranylgeranyl pyrophosphate (GGPP) to phytoene, and lycopene cyclase activity, which transforms lycopene into β-carotene . This dual functionality in a single protein represents an interesting evolutionary adaptation that streamlines the carotenoid biosynthetic pathway in this yeast species.

Taxonomic Context

Phaffia rhodozyma, reclassified as Xanthophyllomyces dendrorhous, is a basidiomycetous yeast renowned for its ability to produce astaxanthin, a high-value carotenoid pigment. This organism serves as an important model system for studying carotenoid biosynthesis in fungi and has garnered significant biotechnological interest due to its natural capacity to produce astaxanthin at levels exceeding most other natural sources . The specialized enzymatic machinery of P. rhodozyma, particularly the crtYB enzyme, contributes substantially to its carotenoid-producing capabilities.

Protein Structure and Domains

The crtYB protein exhibits a domain organization that reflects its bifunctional nature. Based on comparative analysis with similar bifunctional enzymes such as the carRP gene product in Mucor circinelloides, crtYB likely contains two distinct functional domains: a lycopene cyclase domain at the N-terminus and a phytoene synthase domain at the C-terminus . This structural arrangement enables the protein to efficiently catalyze two different reactions in the carotenoid biosynthetic pathway within a single polypeptide chain.

Amino Acid Sequence and Properties

The complete amino acid sequence of recombinant crtYB consists of 673 amino acids and begins with "MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFSAT..." as documented in available protein databases . The enzyme is classified as a transmembrane protein, suggesting membrane association that likely facilitates its interaction with lipophilic carotenoid substrates . For recombinant production purposes, the protein is typically expressed with an N-terminal 10xHis-tag to facilitate purification .

Table 1: Key Characteristics of Recombinant Phaffia rhodozyma crtYB Protein

CharacteristicDetails
UniProt AccessionQ7Z859
Protein Length673 amino acids (full length)
Enzymatic ActivitiesLycopene beta-cyclase (EC 5.5.1.19); Phytoene synthase (EC 2.5.1.32)
Source OrganismPhaffia rhodozyma (Xanthophyllomyces dendrorhous)
Protein TypeTransmembrane protein
Recombinant TagN-terminal 10xHis-tag
Optimal Storage-20°C or -80°C; avoid repeated freezing and thawing

Lycopene Cyclase Activity

The lycopene cyclase function of crtYB catalyzes the conversion of the linear carotenoid lycopene to cyclic β-carotene by introducing β-ionone rings at both ends of the molecule. This critical enzymatic step directs metabolic flux from linear carotenoids toward cyclic carotenoids like β-carotene, which can then be further modified to produce xanthophylls such as astaxanthin . The cyclization reaction involves complex molecular rearrangements and represents a key regulatory point in determining the specific carotenoid profile produced by the organism.

Substrate Interactions and Regulation

Research has revealed important insights into how the crtYB enzyme interacts with its substrates and how these interactions affect pathway efficiency. Notably, the lycopene cyclase activity has been shown to be subject to substrate inhibition, which can become a significant bottleneck in carotenoid biosynthesis . At high concentrations, lycopene can inhibit the cyclase activity, limiting conversion to β-carotene. This regulatory mechanism has likely evolved to maintain balance in the natural carotenoid profile but presents challenges for engineered systems targeting high-level production of specific carotenoids.

The crtYB Gene and Its Manipulation

The crtYB gene encoding this bifunctional enzyme serves as an important genetic element for manipulating carotenoid biosynthesis. Studies have demonstrated that the crtYB locus can function as an integrative platform for constructing specific carotenoid biosynthetic mutants in X. dendrorhous . The gene can be inactivated through both single and double crossover events, resulting in non-carotenoid-producing transformants. Alternatively, overexpression of the crtYB gene, whether linked to its homologous promoter or heterologous promoters like glyceraldehyde-3-phosphate dehydrogenase, leads to altered carotenoid production profiles .

Comparative Analysis with Similar Enzymes

Comparative studies between the crtYB enzyme of P. rhodozyma and similar enzymes in other fungi provide valuable insights into the structure-function relationships of these bifunctional proteins. For instance, the carRP gene of Mucor circinelloides also encodes a bifunctional enzyme with lycopene cyclase and phytoene synthase activities . The carRP gene product contains two domains: the R domain at the N-terminus determines lycopene cyclase activity, while the P domain at the C-terminus is responsible for phytoene synthase activity. Interestingly, the R domain remains functional even without the P domain, while the P domain requires proper R domain conformation to function effectively . This relationship likely applies to crtYB as well, suggesting complex interdomain interactions.

Expression in Heterologous Hosts

The recombinant production of crtYB has been achieved in various heterologous hosts. Escherichia coli has served as an expression system for studying fungal carotenoid biosynthetic enzymes, including bifunctional enzymes similar to crtYB . The availability of detailed protein information, including the complete amino acid sequence and tag specifications, facilitates the production and purification of recombinant crtYB protein in such systems .

Saccharomyces cerevisiae represents another important host for expressing carotenogenic genes from P. rhodozyma. Research has demonstrated that recombinant S. cerevisiae strains carrying crtYB, along with other pathway genes like crtE and crtI, can successfully synthesize β-carotene . These recombinant systems provide valuable platforms for studying crtYB function and for developing biotechnological applications.

Temperature Effects on Recombinant Production

Temperature has been identified as a critical factor affecting β-carotene production in recombinant systems expressing crtYB. Studies with recombinant S. cerevisiae expressing the crtE, crtYB, and crtI genes from P. rhodozyma revealed dramatic differences in β-carotene production at different temperatures . Cells cultivated at 20°C produced approximately 258.8 ± 43.8 μg/g dry cell weight (DCW) of β-carotene, which was 59-fold higher than cells grown at 30°C, despite faster growth at the higher temperature .

Table 2: Effect of Temperature on β-carotene Production in Recombinant S. cerevisiae Expressing crtYB

Strain ConfigurationTemperatureβ-carotene Production (μg/g DCW)Fold Difference
Sc-EYBI (crtE, crtYB, crtI)20°C258.8 ± 43.859-fold higher than at 30°C
Sc-EYBI (crtE, crtYB, crtI)30°C~4.4 (calculated)Reference
Sc-EYBIH (+ cHMG1)20°C528.8 ± 13.327-fold higher than at 30°C
Sc-EYBIH (+ cHMG1)30°C~19.6 (calculated)Reference

When the catalytic domain of 3-hydroxy-3-methylglutaryl-coenzyme A reductase from S. cerevisiae was additionally expressed (Sc-EYBIH), β-carotene levels increased further to 528.8 ± 13.3 μg/g DCW at 20°C, which was 27-fold higher than at 30°C . These findings highlight the profound impact of temperature on the performance of recombinant crtYB and associated enzymes.

Overcoming Production Bottlenecks

One of the significant challenges in carotenoid biosynthesis is the substrate inhibition of lycopene cyclase, which restricts pathway efficiency. Research has identified two promising approaches to overcome this limitation. The first approach involves structure-guided protein engineering to create enzyme variants that lack substrate inhibition while maintaining catalytic activity. For example, a Y27R variant of a lycopene cyclase demonstrated complete elimination of substrate inhibition without reduced enzymatic function . Although this specific research was not conducted on crtYB itself, similar engineering principles could potentially be applied to this enzyme.

The alternative approach establishes a geranylgeranyl pyrophosphate synthase-mediated flux flow restrictor, which prevents substrate inhibition by diverting metabolic flux away from the inhibitory metabolite while maintaining sufficient flux toward product formation . These strategies have enabled the construction of strains capable of producing 39.5 g/L β-carotene at a productivity of 0.165 g/L/h in bioreactor fermentations, representing a remarkable 1441-fold improvement over initial strains .

Engineered Pathway Flux Control

Manipulating the competitive relationship between different enzymes in the carotenoid pathway can significantly alter product profiles. Studies have shown that the competition between phytoene desaturase and lycopene cyclase (crtYB) for lycopene governs the metabolic flux distribution either toward β-carotene and astaxanthin or toward alternative carotenoids like 3,4-didehydrolycopene and 3-hydroxy-3'-4'-didehydro-β-psi-caroten-4-one (HDCO) .

By engineering this competitive balance, researchers have created strains where monocyclic carotenoids like torulene and HDCO become the predominant products rather than the typical carotenoid profile . This demonstrates the potential for fine-tuning carotenoid biosynthesis through strategic manipulation of crtYB expression and activity in relation to other pathway enzymes.

Industrial Applications

The recombinant crtYB enzyme has significant relevance for industrial biotechnology, particularly in the production of high-value carotenoids. The global market for carotenoids like β-carotene and astaxanthin spans multiple industries including food colorants, nutritional supplements, cosmetics, and aquaculture feed additives. Microbial production of these compounds using engineered organisms expressing crtYB offers several advantages over traditional extraction from natural sources or chemical synthesis, including sustainability, potential cost-effectiveness, and year-round production capability independent of seasonal variations.

Food and Pharmaceutical Potential

Carotenoids produced through pathways involving crtYB have important applications in food science and pharmaceuticals. β-carotene serves as a precursor to vitamin A and is widely used as a food colorant and nutritional supplement. Astaxanthin, another carotenoid that can be produced in pathways involving crtYB, has garnered substantial attention for its potent antioxidant properties, which exceed those of most other known antioxidants. These compounds have been suggested to possess various health benefits, including potential antitumor properties and other therapeutic effects . The development of efficient production systems based on recombinant crtYB could help meet the increasing demand for these compounds in both nutritional and pharmaceutical applications.

Recent Advances

Recent research advances related to crtYB and similar enzymes include the development of strategies to overcome substrate inhibition, identification of optimal cultivation conditions for recombinant production, and successful engineering of high-producing carotenoid biosynthetic pathways. The dramatic temperature effects on recombinant enzyme performance represent particularly valuable insights for optimizing production systems . Additionally, the understanding of how bifunctional enzymes like crtYB are structured and regulated continues to evolve, providing new opportunities for enzyme engineering.

Challenges and Future Directions

Despite significant progress, several challenges remain in maximizing the potential of recombinant crtYB. These include further optimizing expression conditions, enhancing protein stability, addressing regulatory bottlenecks in metabolic pathways, and scaling production to industrial levels. Future research directions may include more detailed structural studies of crtYB to better understand the molecular basis of its dual functionality, advanced protein engineering efforts to enhance enzyme performance, and development of more sophisticated regulatory systems for controlled expression.

The integration of omics technologies and systems biology approaches will likely contribute to a more comprehensive understanding of how crtYB functions within the broader context of cellular metabolism. This knowledge could guide the development of more efficient production systems for carotenoids and potentially expand the application scope of this remarkable bifunctional enzyme.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
crtYB; pbs; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Target Names
crtYB
Target Protein Sequence
MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFSATTPWDSWIIRNGA WTYPSAESGQGVFGTFLDVPYEEYAFFVIQTVITGLVYVLATRHLLPSLALPKTRSSALS LALKALIPLPIIYLFTAHPSPSPDPLVTDHYFYMRALSLLITPPTMLLAALSGEYAFDWK SGRAKSTIAAIMIPTVYLIWVDYVAVGQDSWSINDEKIVGWRLGGVLPIEEAMFFLLTNL MIVLGLSACDHTQALYLLHGRTIYGNKKMPSSFPLITPPVLSLFFSSRPYSSQPKRDLEL AVKLLEEKSRSFFVASAGFPSEVRERLVGLYAFCRVTDDLIDSPEVSSNPHATIDMVSDF LTLLFGPPLHPSQPDKILSSPLLPPSHPSRPTGMYPLPPPPSLSPAELVQFLTERVPVQY HFAFRLLAKLQGLIPRYPLDELLRGYTTDLIFPLSTEAVQARKTPIETTADLLDYGLCVA GSVAELLVYVSWASAPSQVPATIEEREAVLVASREMGTALQLVNIARDIKGDATEGRFYL PLSFFGLRDESKLAIPTDWTEPRPQDFDKLLSLSPSSTLPSSNASESFRFEWKTYSLPLV AYAEDLAKHSYKGIDRLPTEVQAGMRAACASYLLIGREIKVVWKGDVGERRTVAGWRRVR KVLSVVMSGWEGQ
Uniprot No.

Target Background

Function
Recombinant *Phaffia rhodozyma* Bifunctional lycopene cyclase/phytoene synthase (crtYB) is a bifunctional enzyme catalyzing the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase activity) and lycopene to β-carotene via the intermediate γ-carotene (lycopene cyclase activity). The cyclase exhibits a preference for symmetric cyclization of both substrate ends, yielding dicyclic carotenoids. β-carotene subsequently undergoes processing to the keto-carotenoid astaxanthin.
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the bifunctional nature of the crtYB gene in Phaffia rhodozyma?

The crtYB gene in Phaffia rhodozyma encodes a chimeric enzyme with dual catalytic functions: phytoene synthase and lycopene cyclase activities. This bifunctionality is unusual among carotenoid biosynthetic enzymes, as these functions are typically encoded by separate genes in most organisms. The enzyme catalyzes two critical steps in the carotenoid biosynthetic pathway: the condensation of two geranylgeranyl pyrophosphate (GGPP) molecules to form phytoene (phytoene synthase activity) and the cyclization of lycopene to form β-carotene (lycopene cyclase activity) . This unique bifunctional characteristic makes crtYB an interesting target for metabolic engineering of carotenoid biosynthesis.

How does genetic manipulation of crtYB affect carotenoid production in Phaffia rhodozyma?

Genetic manipulation of the crtYB gene significantly impacts carotenoid biosynthesis in Phaffia rhodozyma. Inactivation of crtYB through either single or double crossover events results in non-carotenoid-producing transformants, demonstrating its essential role in the pathway . Conversely, overexpression of crtYB, particularly when using strong promoters like the glyceraldehyde-3-phosphate dehydrogenase (gpd) promoter, can enhance carotenoid production in both wild-type strains and β-carotene-accumulating mutants . Homozygous knockout mutants of crtYB (crtYB -/-) exhibit an albino phenotype due to their inability to produce colored carotenoids, while other pathway mutations like crtS -/- result in yellow colonies due to β-carotene accumulation .

What methodology is recommended for cloning and expressing recombinant crtYB?

For successful cloning and expression of recombinant crtYB, the following methodological approach is recommended:

  • Gene Amplification: Design specific primers based on the known crtYB sequence (such as GenBank Accession: OL518982 for R. glutinis) . Use PCR conditions optimized for high GC content typically found in Phaffia genomic DNA (recommended annealing temperature: 55°C for crtYB cDNAs) .

  • Vector Construction: Clone the amplified crtYB gene into a suitable expression vector. For efficient expression in yeast systems, vectors containing strong promoters such as the glyceraldehyde-3-phosphate dehydrogenase (gpd) promoter have proven effective .

  • Transformation Protocol:

    • For expression in Phaffia, electroporation or PEG-mediated transformation can be used with selection based on antibiotic resistance markers.

    • For heterologous expression in Saccharomyces cerevisiae, standard lithium acetate transformation protocols are effective .

  • Expression Verification: Confirm successful transformation and expression through PCR screening, Southern blotting for integration events, and RT-PCR for transcription analysis .

How do alternative splicing events in crtYB transcripts affect carotenoid biosynthesis?

Alternative splicing of crtYB transcripts in Phaffia rhodozyma produces both mature mRNA (mmRNA) and alternative mRNA (amRNA) forms, which significantly influence carotenoid biosynthesis. The amRNA variant retains 55 bp of the first intron while losing 111 bp of the second exon, creating multiple premature stop codons that would result in a non-functional truncated protein . The ratio of mature to alternative mRNA (M/A ratio) varies throughout the growth cycle, with a decreasing trend as the culture ages .

This alternative splicing mechanism likely represents a post-transcriptional regulation strategy that modulates carotenoid biosynthesis in response to environmental conditions and growth phases. Researchers targeting enhanced carotenoid production must consider these splicing dynamics when designing genetic modification strategies.

What are the optimal conditions for heterologous expression of functional crtYB in non-carotenogenic hosts?

Heterologous expression of functional crtYB requires careful optimization of several parameters:

  • Codon Optimization: The GC-rich nature of Phaffia genes can cause expression challenges in hosts with different codon usage preferences. Codon optimization based on the host's preference is recommended for efficient translation.

  • Promoter Selection: For expression in Saccharomyces cerevisiae, strong constitutive promoters including TEF1p, FBA1p, and ALA1p have demonstrated successful expression of carotenogenic genes . The table below compares the relative expression efficiency of different promoters when expressing crtYB in S. cerevisiae:

PromoterRelative Expression Levelβ-Carotene Production
TEF1pHigh++++
GPDpHigh++++
FBA1pMedium+++
ALA1pMedium-Low++
Native Phaffia promoterLow+
  • Terminator Selection: Proper terminators such as ADH1t, HOG1t, and CYC1t ensure correct transcript processing .

  • Supplementary Pathway Genes: For complete carotenoid pathway reconstitution, co-expression of crtYB with other carotenogenic genes is necessary. In S. cerevisiae, the minimal set includes crtE (GGPP synthase) and crtI (phytoene desaturase) . For astaxanthin production, additional genes like crtS (β-carotene hydroxylase) are required.

  • Metabolic Precursor Availability: Ensure sufficient supply of isoprenoid precursors (IPP and DMAPP) by co-expressing genes that enhance the mevalonate pathway or by supplementing the medium with pathway intermediates.

What strategies can overcome the challenges of alternative splicing when engineering crtYB expression?

To overcome challenges associated with alternative splicing of crtYB transcripts, researchers can implement several strategic approaches:

  • Intron-Free Constructs: Design expression constructs using cDNA versions of crtYB that lack intronic sequences, thereby eliminating the possibility of alternative splicing events that produce non-functional proteins .

  • Splice Site Modification: Introduce silent mutations at the native splice sites to prevent recognition by the splicing machinery while maintaining the amino acid sequence of the protein.

  • Synthetic Gene Design: Utilize a completely synthetic crtYB gene with optimized codon usage and no introns, designed specifically for the host organism of choice .

  • Targeted Mutagenesis: Perform site-directed mutagenesis to modify the alternative 5' and 3' splice sites (GT and AG motifs) that lead to the production of crtYB amRNA .

  • Temporal Expression Control: Implement inducible promoter systems that allow expression at specific growth phases to circumvent the natural decline in the mature/alternative mRNA ratio observed during later growth stages .

These strategies have been validated in experimental settings, with intron-free constructs showing the most consistent expression levels across different growth phases.

What are the recommended methods for quantifying crtYB expression levels?

Accurate quantification of crtYB expression is essential for understanding its regulation and optimizing recombinant systems. The following methodological approaches are recommended:

  • Reverse Transcription PCR (RT-PCR):

    • Design primers specific to mature and alternative crtYB transcripts. For mature mRNA, primers spanning exon junctions can be used (e.g., primers 11 and 15 as described in the literature) .

    • For alternative mRNA detection, design primers that specifically amplify the retained intronic region (e.g., primers 12 and 15) .

    • Include an internal standard gene such as actin (act) for normalization .

    • Recommended amplification conditions: 55°C annealing temperature for crtYB cDNAs, with PCR products resolved on 4.5% polyacrylamide gels for optimal separation of splice variants .

  • Quantitative Real-Time PCR (qRT-PCR):

    • More sensitive than conventional RT-PCR for detecting low-abundance transcripts during early growth phases.

    • Calculate relative expression using the 2^(-ΔΔCt) method with appropriate housekeeping genes.

  • RNA-Seq Analysis:

    • Provides comprehensive transcriptome-wide data on expression levels and alternative splicing events.

    • Enables discovery of previously unknown splice variants or regulatory elements.

  • Protein Quantification Methods:

    • Western blotting using antibodies specific to crtYB protein.

    • Activity assays measuring phytoene synthase and lycopene cyclase enzymatic functions.

    • Mass spectrometry for absolute protein quantification.

How can researchers optimize transformation efficiency when introducing recombinant crtYB into Phaffia rhodozyma?

Optimizing transformation efficiency for Phaffia rhodozyma requires attention to several critical factors:

  • Cell Wall Pretreatment:

    • Phaffia has a robust cell wall that can impede DNA uptake. Pretreatment with lithium acetate (LiAc) combined with dithiothreitol (DTT) significantly enhances transformation efficiency.

    • Enzymatic digestion using β-glucanases (5-10 U/ml) for 30-60 minutes at 25°C creates protoplasts with increased transformation susceptibility.

  • Transformation Method Selection:

    • Electroporation: Optimal parameters include field strength of 1.5 kV/cm, capacitance of 25 μF, and resistance of 200 Ω.

    • PEG-mediated transformation: Use 40% PEG-3350 solution and heat shock at 42°C for 15 minutes.

    • Agrobacterium-mediated transformation: Provides stable integration with potentially higher efficiency for some strains.

  • DNA Configuration Optimization:

    • Linear DNA fragments with homologous flanking regions (>500 bp) enhance targeted integration via homologous recombination .

    • For random integration, circular plasmids maintain higher stability during transformation.

  • Selection Strategy:

    • Antibiotic selection: Hygromycin B (50-100 μg/ml) provides effective selection pressure.

    • Phenotypic screening: Visual identification of color phenotypes (albino for crtYB knockouts, yellow for partial pathway disruption) .

    • Implement direct recombinant method (DRM) to enrich for mitotic recombination events, achieving >90% homozygous colonies after selection .

  • Post-Transformation Recovery:

    • Allow 4-6 hours of recovery in rich medium without selection before plating.

    • Maintain lower incubation temperature (18-20°C) during initial recovery phase.

What are the key considerations for designing experiments to investigate crtYB substrate specificity?

Investigating crtYB substrate specificity requires careful experimental design considering both its phytoene synthase and lycopene cyclase activities:

  • In Vitro Enzyme Assays:

    • Purify recombinant crtYB using affinity tags (His-tag or GST-tag) to enable separate assessment of each catalytic function.

    • For phytoene synthase activity: Use geranylgeranyl pyrophosphate (GGPP) as substrate and detect phytoene formation via HPLC.

    • For lycopene cyclase activity: Use purified lycopene as substrate and monitor β-carotene formation.

    • Prepare substrate analogs with modified structures to probe binding pocket requirements.

  • Kinetic Parameter Determination:

    • Measure reaction rates at varying substrate concentrations to determine Km and Vmax values.

    • Compare kinetic parameters between wild-type and mutant variants of crtYB.

    • Assess potential inhibitory effects of pathway intermediates or end products.

  • Site-Directed Mutagenesis Approach:

    • Target conserved domains identified through sequence alignment and structural prediction.

    • Create a library of crtYB variants with mutations in the predicted active sites for each function.

    • Perform activity assays to correlate specific residues with each catalytic function.

  • Heterologous Expression Systems:

    • Express crtYB in carotenoid pathway-free hosts (e.g., E. coli or S. cerevisiae engineered to lack interfering activities).

    • Supply different potential substrates by co-expressing various upstream genes or supplementing with precursors.

    • Analyze resulting carotenoid profiles using HPLC, mass spectrometry, and spectrophotometric methods.

  • Competition Assays:

    • Design experiments with mixed substrates to determine preferential activity and potential regulatory mechanisms.

    • Assess substrate competition under various physiological conditions (temperature, pH, ionic strength).

How can researchers address the common issues encountered when amplifying crtYB from genomic DNA?

Amplification of crtYB from genomic DNA presents several technical challenges due to its high GC content and complex structure. Here are methodological solutions for common issues:

  • High GC Content Challenges:

    • Use specialized polymerases designed for GC-rich templates (e.g., Q5 High-Fidelity DNA Polymerase or Phusion High-Fidelity DNA Polymerase).

    • Add PCR enhancers such as DMSO (5-10%), betaine (1-2M), or 7-deaza-dGTP to prevent secondary structure formation.

    • Implement touchdown PCR protocols starting with annealing temperatures 5-8°C above the calculated Tm.

  • Primer Design Considerations:

    • Design primers with balanced GC content (40-60%).

    • Avoid regions prone to secondary structure formation.

    • For specific detection of splice variants, position primers as described in previous research: use primers spanning exon junctions for mature mRNA and primers targeting retained intron sequences for alternative mRNA .

  • Template Quality Issues:

    • Prepare high-quality genomic DNA using specialized extraction protocols for yeast cells, including extended lyticase treatment.

    • Verify DNA purity using A260/A280 and A260/A230 ratios (optimal values: 1.8-2.0 and 2.0-2.2, respectively).

    • Pretreat DNA preparations with phenol-chloroform extraction if initial amplification attempts fail.

  • Amplification Protocol Optimization:

    • Implement a two-step PCR protocol with combined annealing/extension at 68-72°C.

    • Use longer extension times (1 minute per kb plus additional 30 seconds).

    • Reduce primer concentration to minimize non-specific amplification.

  • Handling Intronic Regions:

    • When complete gene sequences including introns are required, design primers flanking the entire gene region.

    • For expression studies, use cDNA templates prepared from total RNA to avoid intronic complications .

What strategies can resolve expression problems when crtYB fails to produce functional protein?

When recombinant crtYB fails to produce functional protein, researchers can implement these systematic troubleshooting strategies:

  • Expression Construct Verification:

    • Confirm sequence integrity through complete sequencing to verify absence of mutations.

    • Check for proper reading frame alignment and correct start/stop codons.

    • Verify promoter and terminator sequences using restriction mapping and sequencing.

  • Protein Solubility Enhancement:

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist proper folding.

    • Lower expression temperature (16-20°C) to slow translation and allow proper folding.

    • Fuse with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO.

    • Optimize induction conditions (inducer concentration and timing) to prevent aggregation.

  • Codon Optimization Strategies:

    • Analyze the codon adaptation index (CAI) of the native sequence for the expression host.

    • Redesign the gene with host-preferred codons while maintaining key regulatory elements.

    • Consider using synthetic gene constructs with optimized codons for challenging expression systems .

  • Post-Translational Modification Requirements:

    • Evaluate potential requirements for specific post-translational modifications.

    • Select expression hosts capable of performing necessary modifications.

    • Consider fusion partners that can enhance proper folding and modification.

  • Activity Assay Optimization:

    • Develop sensitive and specific activity assays for both enzymatic functions.

    • Include positive controls with known activity levels.

    • Test protein activity under various buffer conditions, pH ranges, and cofactor concentrations.

How can researchers analyze and interpret contradictory data regarding crtYB function across different experimental systems?

When faced with contradictory data on crtYB function across different experimental systems, researchers should employ these methodological approaches for resolution:

  • Systematic Comparison Framework:

    • Create a comprehensive comparison table documenting all experimental variables: host organism, expression system, growth conditions, detection methods, and quantification approaches.

    • Standardize units and normalization methods across studies to enable direct comparison.

    • Identify key differences in experimental design that might explain contradictory results.

  • Cross-Validation Studies:

    • Replicate experiments using standardized protocols across different systems.

    • Perform parallel experiments using multiple detection methods to verify results.

    • Collaborate with laboratories reporting contradictory results to identify methodology differences.

  • Genetic Background Considerations:

    • Evaluate the impact of host strain genetic backgrounds on crtYB function.

    • Consider epigenetic factors that might influence gene expression in different hosts.

    • Assess the presence of host factors that might interact with or modify crtYB activity.

  • Environmental Variable Analysis:

    • Systematically test the influence of growth conditions (temperature, pH, media composition) on crtYB activity.

    • Evaluate time-dependent effects, as expression patterns change throughout culture growth .

    • Consider light conditions, as carotenoid biosynthesis can be photoregulated in some systems.

  • Biochemical Characterization Consistency:

    • Perform detailed kinetic analyses under identical conditions.

    • Isolate enzyme from different expression systems and compare intrinsic properties.

    • Conduct in vitro reconstitution experiments with purified components to eliminate host-specific effects.

What are promising approaches for engineering crtYB to enhance specific carotenoid production?

Several promising approaches exist for engineering crtYB to enhance specific carotenoid production:

  • Structure-Guided Protein Engineering:

    • Apply structural biology techniques (X-ray crystallography, cryo-EM) to determine the three-dimensional structure of crtYB.

    • Identify active site residues for each catalytic function through molecular docking simulations.

    • Design rational mutations to alter substrate specificity or product selectivity.

    • Implement computational protein design to optimize enzyme performance for desired products.

  • Directed Evolution Strategies:

    • Develop high-throughput screening systems based on carotenoid color phenotypes.

    • Apply error-prone PCR to generate crtYB variant libraries.

    • Implement CRISPR-based systems for in vivo directed evolution.

    • Use DNA shuffling between crtYB genes from diverse organisms to create chimeric enzymes with novel properties.

  • Biosynthetic Pathway Modulation:

    • Balance expression levels of crtYB relative to other pathway enzymes to prevent bottlenecks.

    • Engineer transcriptional regulators controlling crtYB expression.

    • Manipulate alternative splicing mechanisms to favor productive mmRNA forms over amRNA variants .

    • Develop synthetic regulatory circuits for dynamic control of expression in response to metabolic conditions.

  • Subcellular Localization Optimization:

    • Direct crtYB to specific cellular compartments to enhance substrate access.

    • Create fusion proteins with membrane-targeting domains to facilitate interaction with membrane-bound substrates.

    • Engineer protein scaffolds to co-localize multiple carotenoid biosynthetic enzymes for enhanced pathway flux.

  • Heterologous Multi-Enzyme Systems:

    • Combine engineered crtYB variants with complementary enzymes from diverse sources.

    • Develop modular expression systems allowing rapid testing of different enzyme combinations.

    • Create synthetic operons optimized for specific carotenoid production targets.

How might single-cell analysis techniques advance our understanding of crtYB regulation?

Single-cell analysis techniques offer revolutionary approaches to understanding crtYB regulation:

  • Single-Cell RNA Sequencing Applications:

    • Reveal cell-to-cell heterogeneity in crtYB expression within populations.

    • Identify subpopulations with distinct regulatory patterns.

    • Detect rare regulatory events masked in bulk analyses.

    • Map the dynamics of alternative splicing at single-cell resolution.

  • Time-Resolved Single-Cell Protein Analysis:

    • Track crtYB protein levels throughout the cell cycle using fluorescent protein fusions.

    • Correlate protein abundance with carotenoid accumulation at the single-cell level.

    • Identify post-translational modifications through single-cell proteomics.

    • Measure enzyme kinetics in individual cells using activity-based protein profiling.

  • Spatial Transcriptomics and Proteomics:

    • Map subcellular localization of crtYB mRNA and protein.

    • Correlate spatial distribution with functional outcomes.

    • Investigate co-localization with other pathway components.

    • Determine the relationship between enzyme localization and carotenoid accumulation sites.

  • Live-Cell Imaging Techniques:

    • Visualize dynamic changes in crtYB expression using reporter constructs.

    • Track alternative splicing events in real-time using splicing-sensitive fluorescent reporters.

    • Monitor enzyme-substrate interactions using FRET-based biosensors.

    • Correlate enzyme activity with carotenoid accumulation using hyperspectral imaging.

  • Single-Cell Metabolomics:

    • Develop methods to measure carotenoid intermediates at single-cell resolution.

    • Correlate metabolic profiles with crtYB expression patterns.

    • Identify metabolic branch points and regulatory nodes at unprecedented resolution.

    • Determine how heterogeneity in crtYB function contributes to population-level phenotypes.

What interdisciplinary approaches could provide new insights into the evolution and function of bifunctional crtYB?

Interdisciplinary approaches offer powerful new perspectives on crtYB evolution and function:

  • Phylogenomic Analysis Combined with Structural Biology:

    • Reconstruct the evolutionary history of crtYB across diverse organisms.

    • Map evolutionary conservation patterns onto protein structural models.

    • Identify ancestral sequences and characterize their functional properties.

    • Determine how bifunctionality emerged through domain fusion or neofunctionalization events.

  • Systems Biology and Mathematical Modeling:

    • Develop comprehensive models of carotenoid biosynthetic networks.

    • Simulate the effects of crtYB regulation on pathway flux.

    • Predict optimal expression levels for different product targets.

    • Model the dynamic interplay between alternative splicing and enzyme function .

  • Synthetic Biology and Bioengineering Approaches:

    • Redesign carotenoid pathways incorporating orthogonal regulatory systems.

    • Create minimal synthetic pathways to isolate and study crtYB function.

    • Develop cell-free expression systems for rapid testing of crtYB variants.

    • Engineer microbial consortia with distributed carotenoid biosynthetic functions.

  • Biophysical Techniques and Computational Simulation:

    • Apply advanced spectroscopy to characterize enzyme-substrate interactions.

    • Use molecular dynamics simulations to understand conformational changes during catalysis.

    • Implement quantum mechanical calculations to model reaction mechanisms.

    • Develop machine learning approaches to predict enzyme function from sequence.

  • Ecological and Environmental Genomics:

    • Study crtYB variation in natural Phaffia populations from diverse environments.

    • Correlate genetic variations with habitat-specific adaptations.

    • Investigate the role of carotenoids in stress response and ecological fitness.

    • Explore horizontal gene transfer events shaping carotenoid biosynthesis evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.