Recombinant Phage shock protein C (pspC)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Bacterial Stress Response

PspC plays dual roles in sensing membrane damage and activating transcriptional regulation:

Stress Sensing and Signal Transduction

  • Membrane Stress Detection: Acts as a sensor for disruptions in the inner membrane (e.g., secretin toxicity, ethanol exposure) .

  • Interaction with PspB: Forms a complex with PspB to transmit stress signals to the cytoplasmic effector PspA .

  • Activation of PspA: Dislodges PspA from the transcriptional activator PspF, enabling psp operon transcription .

Independent Roles in Pathogenesis

  • Gram-Positive Bacteria: In S. mutans, PspC homolog (PCP) mediates biofilm formation by:

    • Releasing extracellular DNA (eDNA) to stabilize biofilm matrix.

    • Enhancing platelet adhesion via fibrinogen-dependent binding .

  • Virulence in Y. enterocolitica: pspC-null mutants show reduced virulence in mouse models, independent of PspA .

Recombinant PspC: Production and Applications

Recombinant PspC is typically expressed in E. coli with an N-terminal His-tag for purification:

ParameterDetailSource
Expression SystemE. coli (strain unspecified)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol recommended for stability

Applications:

  • Structural Studies: Topology mapping and membrane-protein interaction assays .

  • Functional Assays: Testing PspC’s role in biofilm formation (e.g., S. mutans) or PspA/PspF interactions .

Gram-Negative Bacteria

OrganismKey FindingSource
Y. enterocoliticaPspC’s cytoplasmic N- and C-termini enable interaction with FtsH protease and PspA
V. choleraePspC acts as a positive regulator of the Psp response, alongside PspB and PspF
E. coliPspC–PspA interaction releases PspF, enabling σ⁵⁴-dependent transcription of pspABC

Gram-Positive Bacteria

OrganismKey FindingSource
S. mutansPCP (PspC homolog) is essential for biofilm formation and platelet adhesion via eDNA release
S. pneumoniaePspC homologs are conserved but uncharacterized in pathogenesis

Comparative Evolutionary Analysis

PspC’s genomic context varies across bacterial lineages:

LineagePspC ContextSource
ProteobacteriaPart of pspFABC operon; often paired with PspB
FirmicutesFound as a standalone gene (e.g., pcp in S. mutans)
ActinobacteriaAbsent; PspA homologs linked to clgRpspAMN operon

This modularity suggests lineage-specific adaptation to envelope stress mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
pspC; Z2479; ECs1883; Phage shock protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
pspC
Target Protein Sequence
MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL
Uniprot No.

Target Background

Function
The phage shock protein (psp) operon (pspABCDE) plays a significant role in bacterial survival under nutrient or energy-limiting conditions. PspC is involved in transcriptional regulation.
Database Links

KEGG: ece:Z2479

STRING: 155864.Z2479

Protein Families
Phageshock PspC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Phage Shock Protein C (PspC) and what is its fundamental role in bacterial cells?

PspC is an integral cytoplasmic membrane protein that plays a crucial role in the bacterial phage shock protein (Psp) stress response system. This system is well-conserved in Gram-negative bacteria and responds primarily to extracytoplasmic stress that compromises cytoplasmic membrane integrity. PspC works together with PspB to induce the Psp stress response, which is essential for virulence in Yersinia enterocolitica and prevents cytoplasmic membrane permeability breach when secretin proteins mislocalize to the cytoplasmic membrane .

The Psp system, including PspC, has been most extensively studied in Y. enterocolitica and Escherichia coli. It has been associated with several important phenotypes, including bacterial virulence, biofilm formation, macrophage infection, and bacterial persistence .

How do I determine PspC membrane topology in my bacterial system of interest?

To accurately determine PspC membrane topology, employ multiple complementary approaches:

When interpreting results, consider that earlier studies in E. coli suggested a different topology (C terminus outside) compared to more recent comprehensive studies in Y. enterocolitica (both termini inside), indicating PspC spans the membrane twice .

What is the current understanding of PspC membrane topology and how does it relate to function?

Current research has revised the traditional model of PspC topology. While in silico analyses produced conflicting predictions, experimental evidence from Y. enterocolitica using multiple independent approaches (PhoA fusions, GFP fusions, and BACTH analysis) revealed that both the N and C termini of PspC are located in the cytoplasm . This indicates that PspC spans the membrane twice, with both termini exposed to the cytoplasm.

This topology aligns well with PspC's functional interactions:

  • The cytoplasmic N terminus interacts with the cytoplasmic domain of PspB, forming a regulatory complex that senses stress signals. Mutations in this region often cause constitutive activation of the Psp response .

  • The cytoplasmic C terminus contains a leucine zipper-like amphipathic helix that serves as the binding interface for PspA. Mutations in this region prevent activation rather than causing constitutive activation, indicating a role in positive regulation .

This arrangement allows PspBC to sense membrane stress and relay this information by interacting with PspA, relocating it to the membrane and freeing PspF to activate transcription of psp genes.

What protein-protein interactions does PspC participate in and how do they regulate the Psp response?

PspC participates in several critical protein-protein interactions that regulate the Psp response:

  • PspC-PspB interaction: PspC forms a complex with PspB, which stabilizes PspC against FtsH protease-dependent degradation. The N terminus of PspC can be cross-linked to the cytoplasmic domain of PspB, suggesting interaction in this region .

  • PspC-PspA interaction: The C-terminal leucine zipper-like amphipathic helix of PspC serves as the binding interface for PspA. This interaction is crucial for the regulatory function of the Psp system . When PspBC senses stress, it promotes the relocation of PspA to the inner membrane, which frees cytoplasmic PspF from inhibition by PspA.

  • PspC-FtsH interaction: In the absence of PspB, PspC is subject to degradation by the FtsH protease, which recognizes PspC through its C-terminal domain. Mutations in the C-terminal 22 amino acids (L118P, V125D, and F130S) increase PspC stability when produced without PspB .

These interactions form a regulatory network that allows precise control of the Psp response, ensuring it is activated only under appropriate stress conditions.

What specific signals or stressors induce the Psp response and how does PspC sense these signals?

The Psp response is induced primarily by extracytoplasmic stress. Specific inducers include:

  • Secretin proteins (such as YsaC): These ring-like outer membrane pore-forming proteins potently activate the Psp system when they mislocalize to the cytoplasmic membrane .

  • Specific inner membrane proteins (IMPs): Overexpression of proteins like YggT, AmpE, and a YPO0432 ortholog strongly induces Psp expression (30-fold to >100-fold increase) .

  • Genetic disruptions: Null mutations in genes like glmS (glucosamine-6-phosphate synthetase) involved in cell envelope biosynthesis, or atpB and other genes in the atp operon (F₀F₁ ATPase components) .

InducerFold Induction of pspA-lacZInduction of Other Stress Responses
YsaC30-100+No significant induction of RpoE or Cpx
YggT30-100+No significant induction of RpoE or Cpx
AmpE30-100+No significant induction of RpoE or Cpx
YPO0432 ortholog30-100+No significant induction of RpoE or Cpx
glmS mutationSignificantInduces RpoE and Cpx responses
atp operon mutationsSignificantNo significant induction of RpoE or Cpx

Importantly, the Psp response appears to be induced distinctly from other stress response systems like RpoE and Cpx, suggesting it responds to unique signals related to membrane integrity .

How can I design experiments to study the FtsH-dependent degradation of PspC and the protective role of PspB?

To study FtsH-dependent degradation of PspC and PspB's protective role:

  • Construct expression systems:

    • Create inducible expression plasmids for PspC (with and without mutations)

    • Design systems to express PspC with or without PspB

    • Consider using epitope tags for detection while ensuring they don't interfere with function

  • Analyze degradation kinetics:

    • Perform pulse-chase experiments to measure PspC half-life in the presence/absence of PspB

    • Use western blotting to monitor steady-state PspC levels under different conditions

    • Compare wild-type cells with FtsH-deficient strains to confirm FtsH dependency

  • Investigate the C-terminal recognition site:

    • Create a systematic set of mutations in the C-terminal 22 amino acids of PspC

    • Focus on known stabilizing mutations (L118P, V125D, F130S) and surrounding residues

    • Measure stability of each mutant when expressed without PspB

  • Examine PspB protection mechanism:

    • Design co-expression experiments with varying ratios of PspB:PspC

    • Create PspB mutants to identify regions required for protecting PspC

    • Use co-immunoprecipitation to verify complex formation

  • Visualization approaches:

    • Use fluorescently tagged proteins to monitor degradation in real-time

    • Consider FRET-based approaches to examine PspB-PspC interactions in vivo

This systematic approach will provide insights into the molecular mechanisms of FtsH recognition and PspB protection .

How can I optimize recombinant expression and purification of PspC for structural and functional studies?

Optimizing recombinant PspC expression and purification requires addressing several challenges:

  • Expression system selection:

    • Host: Consider E. coli strains with deleted/controlled native psp operon to prevent interference

    • Vectors: Use tightly controlled expression systems (T7, arabinose, or IPTG-inducible)

    • Co-expression: Include PspB to stabilize PspC against FtsH-dependent degradation

    • Consider C-terminal mutations (L118P, V125D, or F130S) that increase stability if expressing without PspB

  • Fusion design:

    • N-terminal tags are preferred since both termini are cytoplasmic

    • Include purification tags (His, GST) with protease cleavage sites

    • Consider MBP fusion for improved solubility

  • Expression conditions:

    • Lower induction temperature (16-20°C) to improve folding

    • Use rich media supplemented with appropriate antibiotics

    • Induce at mid-log phase with optimized inducer concentration

    • Extended expression periods (overnight at low temperature)

  • Membrane extraction:

    • Screen multiple detergents: begin with mild options like DDM, LDAO

    • Optimize detergent:protein ratios to prevent aggregation

    • Consider adding phospholipids to stabilize the protein

  • Purification strategy:

    • Maintain detergent above CMC throughout purification

    • Include stabilizing agents (glycerol, specific lipids)

    • Use size exclusion chromatography as a final polishing step

    • Verify protein quality by SDS-PAGE and functional assays

  • Functional validation:

    • Verify membrane incorporation using fractionation

    • Test interaction with binding partners (PspB, PspA)

    • Assess ability to complement a ΔpspC strain

These strategies will help overcome the challenges inherent in working with membrane proteins like PspC.

What experimental approaches can effectively distinguish between different models of PspC function in the Psp response?

To distinguish between different models of PspC function:

  • Genetic complementation analysis:

    • Create a library of PspC variants with mutations in specific domains

    • Express these in a ΔpspC background under inducing conditions

    • Measure complementation via reporter assays (pspA-lacZ) and phenotypic tests

    • Create a functional map correlating protein regions with specific activities

  • Domain swapping and chimeric proteins:

    • Exchange domains between PspC homologs from different organisms

    • Create chimeras between PspC and other membrane proteins with similar topology

    • Test functionality of these constructs in vivo

  • Separation-of-function mutants:

    • Identify mutations that specifically disrupt:

      • PspB binding (likely N-terminal)

      • PspA binding (C-terminal amphipathic helix)

      • Stress sensing capability

      • FtsH recognition (C-terminal mutations L118P, V125D, F130S)

    • Characterize these mutants using functional and interaction assays

  • In vivo crosslinking:

    • Use photo-activatable or chemical crosslinkers at specific positions

    • Identify interaction partners under different conditions (basal vs. stressed)

    • Map interaction interfaces through systematic crosslinking

  • Real-time monitoring of protein dynamics:

    • Create fluorescent protein fusions that retain functionality

    • Track protein localization and interactions during stress induction

    • Use FRET pairs to monitor conformational changes and protein interactions

  • Reconstitution experiments:

    • Purify components and reconstitute into liposomes

    • Test minimal components needed for stress sensing and signal transduction

    • Measure membrane properties under different conditions

By combining these approaches, researchers can develop and test refined models of PspC function in the Psp response.

How should I interpret apparently contradictory results from different PspC topology mapping approaches?

When facing contradictory results from topology mapping experiments, as seen with PspC:

  • Evaluate method-specific limitations:

    • PhoA fusions: Low but detectable activity with PspC-PhoA (~240 Miller units) was nearly 50-fold lower than the positive control (~11,300 Miller units), suggesting possible artifacts rather than true periplasmic localization

    • GFP fusions: Both N and C-terminal fusions showed comparable fluorescence, strongly suggesting cytoplasmic localization of both termini

    • BACTH analysis: Supported cytoplasmic localization of both termini

  • Consider protein-specific characteristics:

    • Evaluate whether hydrophobic regions might cause misleading results with certain reporters

    • Assess if the protein adopts mixed topologies in the membrane

    • Determine if fusion proteins might alter native topology

  • Integrate with functional data:

    • PspC C-terminus interacts with cytoplasmic PspA, supporting cytoplasmic localization

    • C-terminus is recognized by cytoplasmic FtsH protease, further supporting cytoplasmic location

    • Mutations in C-terminal amphipathic helix affect function in ways consistent with cytoplasmic location

  • Weight of evidence approach:

    • When multiple independent methods support one model (both termini in cytoplasm), this outweighs a single conflicting result

    • Consider methodological robustness and controls in each experiment

    • Evaluate consistency with broader biological context and homologous proteins

The PspC case demonstrates that integrated analysis of multiple approaches is essential for accurate topology determination, with functional data providing crucial support for structural models.

What controls should be included when studying specific inducers of the Psp response?

When studying specific inducers of the Psp response, include these essential controls:

  • Positive and negative controls for induction:

    • Positive: Known Psp inducers like secretin overexpression (YsaC)

    • Negative: Empty vector or non-inducing protein expression

    • Dose-response controls with titratable expression systems

  • Reporter system controls:

    • Multiple reporter constructs (pspA-lacZ plus direct PspA protein measurement)

    • Control reporters for other stress responses (cpxP-lacZ, rpoE-lacZ) to assess specificity

    • Constitutive reporter to normalize for general effects on gene expression

  • Genetic background controls:

    • Wild-type strain versus defined mutants (ΔpspA, ΔpspBC, ΔpspF)

    • Complemented strains to verify phenotype restoration

    • FtsH-deficient strains to control for protein stability effects

  • Experimental condition controls:

    • Time-course measurements to capture dynamics

    • Growth phase standardization

    • Media composition consistency

    • Temperature consistency

  • Protein expression controls:

    • Verification of inducer protein levels by western blot

    • Membrane fractionation to confirm proper localization

    • Functional verification of expressed proteins

  • Physiological state controls:

    • Growth curves to assess general cellular health

    • Membrane integrity measurements

    • ATP levels or proton motive force measurements for energy state

This comprehensive set of controls will help distinguish genuine Psp inducers from experimental artifacts and provide context for interpreting results within the broader stress response network .

How can I determine if mutations in PspC affect its stability, function, or both?

To distinguish between effects on PspC stability versus function:

  • Stability assessment:

    • Quantify steady-state protein levels by western blotting

    • Compare protein levels in the presence/absence of PspB to detect FtsH-dependent degradation

    • Conduct pulse-chase experiments to measure protein half-life

    • Create a stability comparison table for different mutations:

    PspC VariantLevel with PspBLevel without PspBStability Ratio
    Wild-typeHighLowHigh
    L118PHighHighLow
    V125DHighHighLow
    F130SHighHighLow
    L69PLowVery lowHigh
    C43SHighLowHigh

    Based on data from , mutations L118P, V125D, and F130S specifically affect stability by preventing FtsH recognition, while L69P affects inherent stability regardless of PspB presence.

  • Functional assessment:

    • Measure ability to induce pspA-lacZ expression

    • Test interaction with partner proteins (PspA, PspB) using pull-down or BACTH assays

    • Assess membrane localization

    • Evaluate complementation of ΔpspC phenotypes

    • Determine if mutations affect PspA binding:

    PspC VariantpspA-lacZ InductionPspA BindingPspB Binding
    Wild-typeStrongStrongStrong
    C-terminal mutationsWeakWeakStrong
  • Integrated analysis:

    • Create a classification matrix plotting stability vs. function

    • Compare mutations in different regions (N-terminal, transmembrane, C-terminal)

    • Correlate with structural features (amphipathic helix, transmembrane domains)

    • Distinguish "separation of function" mutations that affect only specific activities

  • Context-dependent assessment:

    • Test function under different stress conditions

    • Evaluate dose-dependence by varying expression levels

    • Assess in different genetic backgrounds

This systematic approach will reveal whether mutations primarily affect protein stability, specific functional interactions, or both aspects of PspC biology .

How can PspC research contribute to understanding bacterial stress responses and developing new antimicrobial strategies?

PspC research offers significant insights for antimicrobial development:

  • Bacterial virulence and persistence:

    • The Psp system is essential for virulence in Y. enterocolitica and S. enterica serovar Typhimurium

    • PspC helps maintain membrane integrity during infection and stress

    • Targeting PspC could potentially attenuate virulence without directly killing bacteria, reducing selection pressure for resistance

  • Membrane integrity mechanisms:

    • PspC research reveals fundamental processes of bacterial membrane homeostasis

    • Understanding these mechanisms can identify new vulnerabilities

    • The distinct nature of the Psp response compared to other stress systems (RpoE, Cpx) provides unique targeting opportunities

  • Potential therapeutic approaches:

    • Inhibitors of PspC-PspB interaction could destabilize PspC via FtsH degradation

    • Molecules targeting the C-terminal amphipathic helix could prevent PspA binding and response activation

    • Compounds that mimic Psp inducers could constitutively activate the system, depleting energy resources

  • Biofilm disruption:

    • The Psp system is important for biofilm formation in E. coli

    • PspC-targeting strategies might disrupt biofilms, enhancing antibiotic effectiveness

    • Combined therapies targeting Psp alongside conventional antibiotics could increase efficacy

  • Bacterial persistence:

    • Psp system has been implicated in bacterial persistence

    • Targeting PspC might sensitize persistent bacteria to antibiotics

    • This approach could address the challenge of recurrent infections

  • Diagnostic applications:

    • Monitoring Psp activation could serve as a biomarker for certain infection types

    • PspC detection might indicate active stress response during infection

Understanding the precise molecular mechanisms of PspC function provides rational targets for developing novel antimicrobials that could complement our current arsenal against resistant pathogens.

What approaches should I use to study potential differences in PspC function across different bacterial species?

To investigate PspC functional differences across bacterial species:

  • Comparative genomic analysis:

    • Perform comprehensive bioinformatic analysis of PspC homologs

    • Create phylogenetic trees to trace evolutionary relationships

    • Identify conserved domains and species-specific features

    • Map sequence conservation onto predicted structural models

  • Cross-species complementation:

    • Express PspC homologs from various species in a Y. enterocolitica or E. coli ΔpspC strain

    • Measure complementation efficiency using pspA-lacZ reporters and phenotypic assays

    • Create chimeric proteins swapping domains between species

    • Identify species-specific differences in induction conditions

  • Protein-protein interaction comparison:

    • Use BACTH or pull-down assays to compare interaction profiles

    • Test if PspC from one species can interact with PspA/PspB from another

    • Map interaction interfaces through mutagenesis

    • Quantify interaction strengths across homologs

  • Stress response profiling:

    • Compare induction conditions across species using standardized reporters

    • Characterize response to secretins, IMPs, and other inducers in different bacteria

    • Develop species-specific reporter systems to monitor native responses

    • Create a comparative table of induction patterns:

    SpeciesSecretin ResponseIMP Responseatp Mutation ResponseglmS Mutation Response
    Y. enterocoliticaStrongStrongStrongStrong
    E. coli????
    S. enterica????
  • Structural biology approaches:

    • Solve structures of PspC homologs from different species

    • Compare membrane topology using consistent methodologies

    • Identify structural features that might explain functional differences

  • Host-pathogen interaction studies:

    • Compare the role of PspC in virulence across pathogens

    • Assess impact on survival within macrophages

    • Evaluate contribution to biofilm formation in different species

This multi-faceted approach will reveal both universal aspects of PspC function and species-specific adaptations that could be exploited for targeted antimicrobial development.

How can I design a comprehensive study to resolve conflicting models of PspC signaling in stress response activation?

To resolve conflicting models of PspC signaling:

  • Define precise hypotheses based on competing models:

    • Model 1: PspC undergoes conformational change upon stress sensing

    • Model 2: PspC relocalization is the key signaling event

    • Model 3: Changes in PspC-PspB-PspA interactions drive signaling

    • Design experiments that specifically distinguish between these possibilities

  • Create reporter systems for real-time monitoring:

    • Develop FRET-based biosensors to detect conformational changes

    • Design split fluorescent protein systems to monitor protein-protein interactions

    • Establish fluorescent protein fusions that maintain functionality

  • Site-directed mutagenesis approach:

    • Create a comprehensive library of PspC variants:

      • Mutations in transmembrane domains

      • Alterations to the C-terminal amphipathic helix

      • Modifications to potential sensing regions

    • Test each variant for:

      • Stress sensing capability

      • Protein-protein interactions

      • Ability to induce the Psp response

    • Map functional regions to develop a detailed structural-functional model

  • Time-resolved analysis:

    • Perform time-course experiments following induction

    • Use synchronized cultures and rapid sampling

    • Apply techniques with high temporal resolution:

      • Real-time fluorescence microscopy

      • Time-resolved crosslinking

      • Pulse-chase protein interaction studies

  • In vitro reconstitution:

    • Purify PspC, PspB, and PspA components

    • Reconstitute into membrane mimetics (liposomes, nanodiscs)

    • Test minimal components needed for signal transduction

    • Measure effects on membrane properties and protein interactions

  • Integration with established findings:

    • Topology: Both PspC termini are cytoplasmic

    • C-terminus: Interacts with PspA through amphipathic helix

    • N-terminus: Interacts with PspB

    • Inducers: Include secretins and specific IMPs

This systematic approach will generate a comprehensive dataset that can resolve competing models and provide a unified understanding of PspC signaling in bacterial stress responses.

What are the current knowledge gaps in PspC research and what methodological advances might address them?

Despite significant progress in understanding PspC, several important knowledge gaps remain:

  • Structural details:

    • No high-resolution structure of PspC exists

    • The precise conformation of the C-terminal amphipathic helix is unknown

    • Structural changes during activation remain hypothetical

    Methodological solutions: Cryo-EM of membrane protein complexes; NMR studies of reconstituted systems; advanced computational modeling validated with crosslinking data.

  • Sensing mechanism:

    • The molecular events by which PspC senses stress are unclear

    • Whether PspC directly senses membrane perturbations or requires other components

    • How signal is transmitted from sensing to effector functions

    Methodological solutions: Site-specific labeling with environment-sensitive probes; in vitro reconstitution with defined membrane perturbations; genetic screens for additional components.

  • Species-specific differences:

    • Whether PspC topology and function are consistent across different bacteria

    • How the system has evolved in different ecological niches

    • If PspC function in non-pathogenic species differs from pathogens

    Methodological solutions: Comparative genomics combined with cross-species complementation; systematic topology mapping across species; pathogenesis models with chimeric proteins.

  • Physiological outcomes:

    • The precise mechanism by which PspC maintains membrane integrity

    • Whether PspC has additional functions beyond stress response

    • How PspC contributes to virulence at the molecular level

    Methodological solutions: Quantitative membrane biophysics; proteomics and transcriptomics of Psp mutants; tissue-specific infection models.

  • Therapeutic targeting:

    • Druggability of PspC or its interactions

    • Whether targeting PspC would effectively attenuate virulence

    • Potential for resistance development

    Methodological solutions: High-throughput screening for inhibitors; animal models with inhibitor treatment; evolution experiments to assess resistance potential.

Addressing these knowledge gaps will require integrated approaches combining structural biology, genetics, biochemistry, and advanced imaging techniques.

How can I design a systematic study of PspC inducers to better understand the specificity of the Psp stress response?

To systematically study PspC inducers and Psp response specificity:

  • Comprehensive inducer panel:

    • Known inducers: secretins (YsaC), specific IMPs (YggT, AmpE, YPO0432 ortholog)

    • Related proteins: test homologs and structural relatives

    • Membrane stressors: antimicrobial peptides, detergents, membrane-targeting antibiotics

    • Physiological stresses: pH, temperature, osmotic shock, oxidative stress

    • Genetic perturbations: expand beyond known mutations (glmS, atp operon)

  • Quantitative reporter system:

    • Primary reporter: pspA-lacZ fusion for quantitative measurement

    • Secondary validation: direct measurement of PspA, PspB, PspC protein levels

    • Control reporters: cpxP-lacZ, rpoE-lacZ to assess stress response specificity

    • Real-time reporters: GFP or luciferase under psp control for kinetic studies

  • Experimental design matrix:

    • Concentration gradient: test each inducer at multiple concentrations

    • Time course: measure response dynamics (immediate vs. delayed)

    • Genetic backgrounds: wild-type, ΔpspA, ΔpspBC, ΔpspF; also ΔrpoE, ΔcpxR to test cross-talk

    • Environmental conditions: vary growth phase, temperature, media composition

  • Create a comprehensive inducer profile table:

    InducerpspA-lacZ InductioncpxP-lacZ InductionrpoE-lacZ InductionRequires PspB/CRequires PspFMechanism
    YsaC>100-foldNoNoYesYesSecretin mislocalization
    YggT30-100-foldNoNoYesYesUnknown
    AmpE30-100-foldNoNoYesYesUnknown
    YPO043230-100-foldNoNoYesYesUnknown
    glmS mutationSignificantYesYes??Cell envelope defect
    atp mutationSignificantNoNo??Energy depletion
  • Mechanistic follow-up:

    • For each inducer class, investigate the molecular mechanism

    • Determine if different inducers activate through the same or distinct pathways

    • Use membrane biophysics approaches to characterize effects on membrane properties

    • Assess whether inducers directly interact with PspC or work indirectly

This systematic approach will provide a comprehensive understanding of Psp response specificity and potentially identify novel mechanisms of stress sensing .

What is the most reliable protocol for analyzing PspC membrane topology using multiple complementary approaches?

Below is a comprehensive protocol for analyzing PspC membrane topology using multiple approaches:

Materials Required:

  • Bacterial strains (wild-type and appropriate mutants)

  • Cloning vectors with inducible promoters

  • Reporter genes (phoA, gfp, T18/T25 fragments)

  • Antibodies against PspC and reporter tags

  • Membrane fractionation reagents

  • Enzyme activity assay kits

Protocol:

  • GFP Fusion Analysis:

    a) Construct preparation:

    • Clone pspC with N-terminal GFP fusion (GFP-PspC)

    • Clone pspC with C-terminal GFP fusion (PspC-GFP)

    • Create control constructs with known topology proteins

    b) Expression and analysis:

    • Transform constructs into appropriate bacterial strain

    • Induce expression (typically mid-log phase, 0.1-0.5 mM IPTG)

    • Harvest cells after 3-4 hours

    • Measure fluorescence intensity using fluorometer or microscopy

    • Confirm membrane localization by fractionation and western blotting

  • PhoA Fusion Analysis:

    a) Construct preparation:

    • Create C-terminal PhoA fusion (PspC-PhoA)

    • Include positive control (periplasmic protein-PhoA, e.g., CpxP-PhoA)

    • Include negative control (cytoplasmic protein-PhoA)

    b) Expression and analysis:

    • Transform and express as above

    • Harvest cells and wash with phosphate buffer

    • Measure alkaline phosphatase activity using p-nitrophenyl phosphate

    • Calculate specific activity in Miller units

    • Compare to control values (e.g., CpxP-PhoA ~11,300 units)

  • BACTH Analysis:

    a) Construct preparation:

    • Create PspC-T18 and T18-PspC fusions

    • Create PspC-T25 and T25-PspC fusions

    • Include controls with proteins of known topology

    b) Expression and analysis:

    • Co-transform appropriate pairs into BTH101 strain

    • Plate on LB/X-gal/IPTG plates and incubate 24-48 hours

    • Quantify β-galactosidase activity in liquid cultures

    • Test all possible combinations to verify topology model

When interpreting results, remember that PspC-PhoA showed low but detectable activity in Y. enterocolitica (~240 Miller units), which is much lower than the positive control (~11,300 Miller units), suggesting potential artifacts rather than true periplasmic localization .

What is the optimal strategy for investigating PspC-PspA interactions in bacterial systems?

Optimal Protocol for Investigating PspC-PspA Interactions:

Materials Required:

  • Bacterial expression strains (wild-type and relevant mutants)

  • Expression vectors for PspC variants and PspA

  • Epitope tags and corresponding antibodies

  • Protein purification and interaction buffers

  • Membrane fractionation reagents

  • Crosslinking reagents

Protocol:

  • Co-Immunoprecipitation Assay:

    a) Construct preparation:

    • Create His-tagged PspC (wild-type and mutant variants)

    • Create FLAG-tagged PspA constructs

    • Design appropriate expression vectors with inducible promoters

    b) Expression and cell preparation:

    • Co-transform constructs into desired bacterial strain

    • Grow cultures to mid-log phase and induce expression

    • Harvest cells and prepare membrane fractions

    • Solubilize membranes with mild detergent (e.g., DDM at 1%)

    c) Pull-down procedure:

    • Incubate solubilized membranes with Ni-NTA resin

    • Wash extensively to remove non-specific binding

    • Elute with imidazole buffer

    • Analyze eluates by SDS-PAGE and western blotting for both proteins

    • Compare binding efficiency between wild-type and mutant PspC proteins

  • Bacterial Two-Hybrid Analysis:

    a) Construct preparation:

    • Create PspC-T18 and PspA-T25 fusion constructs

    • Include full-length and domain-specific constructs

    • Create mutant versions targeting the C-terminal amphipathic helix of PspC

    b) Interaction analysis:

    • Co-transform pairs into appropriate reporter strain

    • Grow on selective media with X-gal/IPTG

    • Quantify β-galactosidase activity in liquid cultures

    • Compare interaction strength between wild-type and mutant constructs

    • Create an interaction matrix testing all domains against each other

  • Site-Directed Mutagenesis Analysis:

    a) Design mutagenesis strategy:

    • Target the C-terminal amphipathic helix (residues ~110-142)

    • Create single amino acid substitutions that disrupt helix formation

    • Focus on leucine zipper motifs and charged residues

    • Include mutations L118P, V125D, and F130S known to affect C-terminal function

    b) Functional analysis of mutants:

    • Test each mutant for ability to induce pspA-lacZ expression

    • Perform pull-down assays to quantify PspA binding

    • Verify protein expression and stability by western blotting

    • Create a structure-function map correlating specific residues with interaction strength

  • In vivo Crosslinking:

    a) Crosslinker approach:

    • Introduce cysteine residues at predicted interaction interfaces

    • Treat cells with membrane-permeable crosslinkers

    • Analyze crosslinked products by western blotting

    b) Photo-crosslinking approach:

    • Incorporate photo-reactive amino acids at specific positions

    • UV-irradiate cultures to induce crosslinking

    • Purify complexes and identify interaction sites by mass spectrometry

  • Comparative data analysis:

    Create a comprehensive interaction table:

    PspC VariantpspA-lacZ InductionPspA Pull-down EfficiencyBACTH InteractionCrosslinking Efficiency
    Wild-type++++++++++++
    L118P++++
    V125D++++
    F130S++++
    N-terminal mutations++++++++++++

This integrated approach will provide robust evidence for the specific residues and structural features of PspC that mediate interaction with PspA, with the C-terminal amphipathic helix being the primary candidate based on existing research .

What experimental design is most appropriate for studying inducers of the PspC-dependent stress response?

Experimental Design for Studying PspC-Dependent Stress Response Inducers:

Materials Required:

  • Reporter strain containing pspA-lacZ fusion

  • Control reporter strains (cpxP-lacZ, rpoE-lacZ)

  • Knockout strains (ΔpspA, ΔpspBC, ΔpspF)

  • Expression vectors for potential inducers

  • β-galactosidase assay reagents

  • Western blotting antibodies for PspA, PspB, PspC

  • Membrane fractionation reagents

Protocol:

  • Reporter Strain Construction and Validation:

    a) Strain preparation:

    • Create chromosomal pspA-lacZ transcriptional fusion

    • Generate parallel cpxP-lacZ and rpoE-lacZ reporter strains

    • Construct these reporters in both wild-type and mutant backgrounds

    • Validate reporters using known inducers

    b) Baseline measurements:

    • Determine basal expression levels in each strain

    • Assess variability across growth phases

    • Establish reproducibility thresholds

  • Inducer Screening Protocol:

    a) Genetic inducers:

    • Construct inducible expression vectors for candidate inducers:

      • Secretins (YsaC and others)

      • Inner membrane proteins (YggT, AmpE, YPO0432 ortholog)

      • Control non-inducing proteins

    b) Expression and measurement:

    • Transform expression vectors into reporter strains

    • Grow cultures to mid-log phase

    • Induce expression with appropriate inducer

    • Continue growth for 3-4 hours

    • Harvest cells and measure β-galactosidase activity

    • Calculate fold induction relative to empty vector control

    • Create comprehensive induction table:

    InducerpspA-lacZ InductioncpxP-lacZ InductionrpoE-lacZ InductionInduction in ΔpspBCProtein Level
    YsaC>100-foldMinimalMinimalNoneVerified
    YggT30-100-foldMinimalMinimalNoneVerified
    AmpE30-100-foldMinimalMinimalNoneVerified
    YPO0432 ortholog30-100-foldMinimalMinimalNoneVerified
    Empty vector1-fold1-fold1-fold1-foldN/A
  • Chemical and Physical Stressor Protocol:

    a) Stressor preparation:

    • Select membrane-targeting compounds

    • Prepare concentration gradients below growth-inhibitory levels

    • Include energy metabolism inhibitors

    • Select physical stressors (temperature, pH, osmotic)

    b) Application and measurement:

    • Apply stressors to mid-log phase cultures

    • Monitor growth to ensure sublethal conditions

    • Harvest at defined timepoints (30 min, 1 hr, 3 hr)

    • Measure reporter activation as above

    • Compare specificity across different reporters

  • Genetic Requirement Analysis:

    a) Strain panel construction:

    • Generate reporter strains in various genetic backgrounds:

      • ΔpspA (regulatory protein deletion)

      • ΔpspBC (sensor complex deletion)

      • ΔpspF (transcriptional activator deletion)

      • FtsH-deficient strain

    b) Comparative analysis:

    • Test top inducers in each genetic background

    • Determine which components are essential for induction

    • Create genetic dependency map for each inducer

    • Identify inducer groups with similar genetic requirements

  • Mechanistic Investigation:

    a) For membrane protein inducers:

    • Verify membrane localization

    • Create domain deletion constructs to identify inducing regions

    • Test whether oligomerization is required

    • Assess impact on membrane properties

    b) For genetic perturbations:

    • Confirm gene deletion/mutation effects

    • Perform complementation to verify specificity

    • Measure associated physiological parameters

    • Determine if effects are direct or indirect

This comprehensive approach will systematically identify and characterize specific inducers of the PspC-dependent stress response, distinguishing it from other stress response systems and revealing potential mechanisms of activation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.